(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0533

BA000012.MLL0533     Location/Qualifiers
FT   CDS             complement(392827..394707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0533"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48099"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48099"
FT                   /db_xref="GOA:Q98ML4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98ML4"
FT                   /protein_id="BAB48099.1"
FT                   /translation="MKFLGKKATAMPLVAIAATLALGAPQAGAQGLFDMLFGGGVRHEP
FT                   QGEFPPPPKHKPKVPAGGGGGAKISGPSYYTYKADKLIRVDFSTLSAAPQPATPQDAAF
FT                   VPSATGAAFHDAIAGLSDYELYAEPDIAKALIAYYSANPDFIWVNGTSPNNRAQDAVRV
FT                   LGEAASYGLTPADYTVDVPATTSASTDDAAKLRELVRFEMALSARVLRYAHDAQNGRVE
FT                   PNRMTGYYDFPAKPLDMVGVLKTLAHTQEVRTYLESRHPQNAEYQALRVELEALQASAE
FT                   NEIVVDPKLLLKPGETSPELPKLLSLIARNLDDNMGGTYGELLSRLASSEVYVPELVPL
FT                   IKAVQVKEGMKGDGVIGPRTVALLAGTSKADRLLKVQVALEELRWLPSDLGSPRVFINQ
FT                   PAFTASYIDNGEEKLKTRVVVGRVTNQTAFFYDQIKQVDFHPYWGVPQSIIVNEMLPRL
FT                   RSDPGYLDRAGYEVTDSRGKRIPSSAVNWGAYGANIPYSVRQQPSEANALGELKILFPN
FT                   KHAIYMHDTPQKSFFKQDMRALSHGCVRLQDPRGMAAAVLGTSVDYVAEKLKHGHSTED
FT                   VTRKIPVYVAYFTAWPDMSGKVEYFSDVYDRDSRLKQALDATEAVRSPSS"
     MKFLGKKATA MPLVAIAATL ALGAPQAGAQ GLFDMLFGGG VRHEPQGEFP PPPKHKPKVP        60
     AGGGGGAKIS GPSYYTYKAD KLIRVDFSTL SAAPQPATPQ DAAFVPSATG AAFHDAIAGL       120
     SDYELYAEPD IAKALIAYYS ANPDFIWVNG TSPNNRAQDA VRVLGEAASY GLTPADYTVD       180
     VPATTSASTD DAAKLRELVR FEMALSARVL RYAHDAQNGR VEPNRMTGYY DFPAKPLDMV       240
     GVLKTLAHTQ EVRTYLESRH PQNAEYQALR VELEALQASA ENEIVVDPKL LLKPGETSPE       300
     LPKLLSLIAR NLDDNMGGTY GELLSRLASS EVYVPELVPL IKAVQVKEGM KGDGVIGPRT       360
     VALLAGTSKA DRLLKVQVAL EELRWLPSDL GSPRVFINQP AFTASYIDNG EEKLKTRVVV       420
     GRVTNQTAFF YDQIKQVDFH PYWGVPQSII VNEMLPRLRS DPGYLDRAGY EVTDSRGKRI       480
     PSSAVNWGAY GANIPYSVRQ QPSEANALGE LKILFPNKHA IYMHDTPQKS FFKQDMRALS       540
     HGCVRLQDPR GMAAAVLGTS VDYVAEKLKH GHSTEDVTRK IPVYVAYFTA WPDMSGKVEY       600
     FSDVYDRDSR LKQALDATEA VRSPSS                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page