(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0539

BA000012.MLL0539     Location/Qualifiers
FT   CDS             complement(398331..398942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0539"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48105"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48105"
FT                   /db_xref="GOA:Q98MK8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK8"
FT                   /protein_id="BAB48105.1"
FT                   /translation="MPVITTVEQLEALYGVPGEASLVKELDHVIPEYAAFIAASPFVAL
FT                   ATSGPEGLDCSPRGDLAGFVRIVDPKTVMMPDRRGNNRADSLRNIIRDPRLGLLFLVPG
FT                   SGTTLRINGRAHITTDAELCASFMVDGKAARSVTVIDVDSVYFQCARAIVRSELWNPAK
FT                   HVDPKSLPTPGKILEITSRKNIDGETYDREWPERAKKTMW"
     MPVITTVEQL EALYGVPGEA SLVKELDHVI PEYAAFIAAS PFVALATSGP EGLDCSPRGD        60
     LAGFVRIVDP KTVMMPDRRG NNRADSLRNI IRDPRLGLLF LVPGSGTTLR INGRAHITTD       120
     AELCASFMVD GKAARSVTVI DVDSVYFQCA RAIVRSELWN PAKHVDPKSL PTPGKILEIT       180
     SRKNIDGETY DREWPERAKK TMW                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page