(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0540

BA000012.MLL0540     Location/Qualifiers
FT   CDS             complement(399006..399359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0540"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48106"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK7"
FT                   /protein_id="BAB48106.1"
FT                   /translation="MTAPKELRVSKDRKLLSVTFPNHQPFELPAELLRVASPSAEVQGH
FT                   SPDQRVTVPGKRNVAILKIEPVGNYAVRITFDDFHDTGIFTWNYLHTLGHEKDERWNAY
FT                   LAELAEKGLSRDR"
     MTAPKELRVS KDRKLLSVTF PNHQPFELPA ELLRVASPSA EVQGHSPDQR VTVPGKRNVA        60
     ILKIEPVGNY AVRITFDDFH DTGIFTWNYL HTLGHEKDER WNAYLAELAE KGLSRDR          117
//

If you have problems or comments...

PBIL Back to PBIL home page