(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0558

BA000012.MLL0558     Location/Qualifiers
FT   CDS             complement(409766..410440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0558"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48121"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48121"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ2"
FT                   /protein_id="BAB48121.1"
FT                   /translation="MHQRAALASGDLQPAECGRLSVELDSLAATVRACRICVENPVGKP
FT                   LPHEPRPVLRPSSSARILIASQAPGTKVHLSGMPFTDASGDRLRSWLGVTSDEFYDIEK
FT                   FAIVPMGFCFPGQDAKGGDLPPRRECAPAWRAPLMALMPRIDLVLTIGIYAQSWHMAAA
FT                   RRPSLTETVMDWRAIWENSVGAKVLPLPHPSWRNSGWLKQNPWFEMDLLPFLRSEIRYR
FT                   LG"
     MHQRAALASG DLQPAECGRL SVELDSLAAT VRACRICVEN PVGKPLPHEP RPVLRPSSSA        60
     RILIASQAPG TKVHLSGMPF TDASGDRLRS WLGVTSDEFY DIEKFAIVPM GFCFPGQDAK       120
     GGDLPPRREC APAWRAPLMA LMPRIDLVLT IGIYAQSWHM AAARRPSLTE TVMDWRAIWE       180
     NSVGAKVLPL PHPSWRNSGW LKQNPWFEMD LLPFLRSEIR YRLG                        224
//

If you have problems or comments...

PBIL Back to PBIL home page