(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0572

BA000012.MLL0572     Location/Qualifiers
FT   CDS             complement(419519..420736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0572"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48133"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48133"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MI0"
FT                   /protein_id="BAB48133.1"
FT                   /translation="MLVSQTMRGAAQLNALDVAGRAGMSAGTRFLLYPQAPYVSGYEKP
FT                   EVVWISTSPGLIHPGPEDHRIYVRDPVLAKQPYEYPYLPPFVGAYFPPAEPGFDGHFDN
FT                   LSLHSRQFLAAHAFAAASRVLDIWESYLGKPIVWYFAETYERLEIIPWIDWENAQSGYG
FT                   YLELGRERGADGRGHPYALNFDVIAHEMGHSILFSLFGVPTKGLQDGDFGPFHEANADL
FT                   ISLLSFLHFDSGMDRLLRHSQANLLVLNELNRIGELTGDRQIRLASNSRKMTEVTEEIH
FT                   DRSRPFTGAIFDTLVDLYHAGLVRQGLADERLLRFDIRQVSEADMRRISNFTGDAFRAR
FT                   PFLFKTELIKARDDVALSLARAWTRLDADHLTFAIAASTIIEVSDRIRPAVAASFEENF
FT                   RWREIL"
     MLVSQTMRGA AQLNALDVAG RAGMSAGTRF LLYPQAPYVS GYEKPEVVWI STSPGLIHPG        60
     PEDHRIYVRD PVLAKQPYEY PYLPPFVGAY FPPAEPGFDG HFDNLSLHSR QFLAAHAFAA       120
     ASRVLDIWES YLGKPIVWYF AETYERLEII PWIDWENAQS GYGYLELGRE RGADGRGHPY       180
     ALNFDVIAHE MGHSILFSLF GVPTKGLQDG DFGPFHEANA DLISLLSFLH FDSGMDRLLR       240
     HSQANLLVLN ELNRIGELTG DRQIRLASNS RKMTEVTEEI HDRSRPFTGA IFDTLVDLYH       300
     AGLVRQGLAD ERLLRFDIRQ VSEADMRRIS NFTGDAFRAR PFLFKTELIK ARDDVALSLA       360
     RAWTRLDADH LTFAIAASTI IEVSDRIRPA VAASFEENFR WREIL                       405
//

If you have problems or comments...

PBIL Back to PBIL home page