(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0574

BA000012.MLL0574     Location/Qualifiers
FT   CDS             complement(421516..422664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0574"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48135"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48135"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH8"
FT                   /protein_id="BAB48135.1"
FT                   /translation="MEHYERVGPPADEALTYLMSMRQALGITRIADITGLDRVGIPVVQ
FT                   ATRPFSLSNAVAQGKGVSLARAAISAILESAEGFFAERIEYFDVIHGSAKSLEIPSGRY
FT                   ETWLREPTFADWRDKDTAWVSAENLLGGKCDFVPLELVHTAYLVPPSPCDGIFTPTTTG
FT                   LAAALDETDAITHGILECVERDAIARALQTHGFLQHQRIDPATIDDARVLALLGELARK
FT                   DMIVGLWLAPSPVGLPVIWCHLMESNPRETALLHLPADGSAAAFDPAAAAVQAIREAAQ
FT                   ARLAAISGARDDMTRASYPRYPDWQLIEAHRQLITGGRKDVSFARQRAYRAAGGQTLRG
FT                   SLLARLEESGINAVYLIRLNTSPWNRLSVVRMVIPQLYPLVE"
     MEHYERVGPP ADEALTYLMS MRQALGITRI ADITGLDRVG IPVVQATRPF SLSNAVAQGK        60
     GVSLARAAIS AILESAEGFF AERIEYFDVI HGSAKSLEIP SGRYETWLRE PTFADWRDKD       120
     TAWVSAENLL GGKCDFVPLE LVHTAYLVPP SPCDGIFTPT TTGLAAALDE TDAITHGILE       180
     CVERDAIARA LQTHGFLQHQ RIDPATIDDA RVLALLGELA RKDMIVGLWL APSPVGLPVI       240
     WCHLMESNPR ETALLHLPAD GSAAAFDPAA AAVQAIREAA QARLAAISGA RDDMTRASYP       300
     RYPDWQLIEA HRQLITGGRK DVSFARQRAY RAAGGQTLRG SLLARLEESG INAVYLIRLN       360
     TSPWNRLSVV RMVIPQLYPL VE                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page