(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0595

BA000012.MLL0595     Location/Qualifiers
FT   CDS             complement(461288..462268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0595"
FT                   /product="ATP-binding protein of oligopeptide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48153"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48153"
FT                   /db_xref="GOA:Q98MG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG0"
FT                   /protein_id="BAB48153.1"
FT                   /translation="MTDSPILETRSLGKRFSIGTRFSAEGKRTVHAVDNVSLTVRRGDT
FT                   VGLVGESGCGKSTLARCLVRLYDISVGELLFEGEDITSKSLSELRPLRRRLQMVFQDPS
FT                   ASLNPRRRVGDLVAEPLRIHGKLSSREITARVAELFELVGLLPDHVMRYPHEFSGGQRQ
FT                   RVGIARAIALNPDLVVLDEPVSALDVSVQAQIVNLLADLQEKLNLTYIFIAHDLSVVRQ
FT                   VSTRIAVMYLGSIVEEGPAEQVFATPAHPYSQALISAVPVVETTPSGTRKRIILTGDVP
FT                   SPLKPPFGCRFHPRCPIAVERCRTERPELREYRPGCKVACHFPTV"
     MTDSPILETR SLGKRFSIGT RFSAEGKRTV HAVDNVSLTV RRGDTVGLVG ESGCGKSTLA        60
     RCLVRLYDIS VGELLFEGED ITSKSLSELR PLRRRLQMVF QDPSASLNPR RRVGDLVAEP       120
     LRIHGKLSSR EITARVAELF ELVGLLPDHV MRYPHEFSGG QRQRVGIARA IALNPDLVVL       180
     DEPVSALDVS VQAQIVNLLA DLQEKLNLTY IFIAHDLSVV RQVSTRIAVM YLGSIVEEGP       240
     AEQVFATPAH PYSQALISAV PVVETTPSGT RKRIILTGDV PSPLKPPFGC RFHPRCPIAV       300
     ERCRTERPEL REYRPGCKVA CHFPTV                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page