(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0596

BA000012.MLL0596     Location/Qualifiers
FT   CDS             complement(462277..463236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0596"
FT                   /product="ATP-binding protein of oligopeptide ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48154"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48154"
FT                   /db_xref="GOA:Q98MF9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MF9"
FT                   /protein_id="BAB48154.1"
FT                   /translation="MILSVRDLKVSFRTNDGLVRAIDGVSFDLEESEILGVVGESGSGK
FT                   TVSLLAVMGLITDPNARIEGSIRYKGRELVGLPARELRRLRGNEIAMIFQDPMTALTPV
FT                   YTIGWQIAEQIRAHQNISKAKAMVRVEELLAEVNFPNPHEAMSRYPHQLSGGMRQRAVI
FT                   AMALSCNPALLVADEPTTALDVTVQAGILDLVRKLRATHKSAVVFITHDMGVVSELADR
FT                   VMVMYAGRVVERGSRMELFSDPRHPYTRALLGSIPPLTGEKPRRLPAIPGSPPSLLRLP
FT                   QGCAFGPRCPVHYEPCVTGKPDLGVGTHAAACFRVTQA"
     MILSVRDLKV SFRTNDGLVR AIDGVSFDLE ESEILGVVGE SGSGKTVSLL AVMGLITDPN        60
     ARIEGSIRYK GRELVGLPAR ELRRLRGNEI AMIFQDPMTA LTPVYTIGWQ IAEQIRAHQN       120
     ISKAKAMVRV EELLAEVNFP NPHEAMSRYP HQLSGGMRQR AVIAMALSCN PALLVADEPT       180
     TALDVTVQAG ILDLVRKLRA THKSAVVFIT HDMGVVSELA DRVMVMYAGR VVERGSRMEL       240
     FSDPRHPYTR ALLGSIPPLT GEKPRRLPAI PGSPPSLLRL PQGCAFGPRC PVHYEPCVTG       300
     KPDLGVGTHA AACFRVTQA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page