(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0633

BA000012.MLL0633     Location/Qualifiers
FT   CDS             complement(500287..501126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0633"
FT                   /product="acyl-(acyl-carrier-protein)-UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48187"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48187"
FT                   /db_xref="GOA:Q98MC6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MC6"
FT                   /protein_id="BAB48187.1"
FT                   /translation="MLMKIKTSIHPSSVVEEGAQIGEGVRIGPFCHISADAVIGDGVEL
FT                   VSHVSVMGATTIGASTKVYPMATLGAPPQNTKHKGGRTTLVIGANCTIREGVTMHVGTD
FT                   TSRGETTVGDNGNFLAYAHIAHDCVVGKNATFANGATLGGHCEIGDNVYIGGLSAVHQF
FT                   VRVGDNAFLGGCSAFVGDVIPYAIAVGNRASLRGLNIIGLKRAGLPRSEIYLLRKAYRT
FT                   IFDRSRTVGENIEFAKAEFASSPTAMKIIDFISSRGKRHYAVPSLKGGDGDDTDDED"
     MLMKIKTSIH PSSVVEEGAQ IGEGVRIGPF CHISADAVIG DGVELVSHVS VMGATTIGAS        60
     TKVYPMATLG APPQNTKHKG GRTTLVIGAN CTIREGVTMH VGTDTSRGET TVGDNGNFLA       120
     YAHIAHDCVV GKNATFANGA TLGGHCEIGD NVYIGGLSAV HQFVRVGDNA FLGGCSAFVG       180
     DVIPYAIAVG NRASLRGLNI IGLKRAGLPR SEIYLLRKAY RTIFDRSRTV GENIEFAKAE       240
     FASSPTAMKI IDFISSRGKR HYAVPSLKGG DGDDTDDED                              279
//

If you have problems or comments...

PBIL Back to PBIL home page