(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0634

BA000012.MLL0634     Location/Qualifiers
FT   CDS             complement(501134..501592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0634"
FT                   /product="(3R)-hydroxymyristoyl-[acyl carrier protein]
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48188"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48188"
FT                   /db_xref="GOA:Q98MC5"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MC5"
FT                   /protein_id="BAB48188.1"
FT                   /translation="MVAATTLEAVDIMGLMKLLPHRYPFLMIDRIIDIDGDDSAIGIKN
FT                   VTINEPHFQGHFPEQPVMPGVLIVEAMAQTAGAICIRSLGASKPSLVYFLTIDNAKFRK
FT                   PVVPGDQLKIHVKKIKKRGNLLKFACEALVDGTKAAEAEISAMMVTGD"
     MVAATTLEAV DIMGLMKLLP HRYPFLMIDR IIDIDGDDSA IGIKNVTINE PHFQGHFPEQ        60
     PVMPGVLIVE AMAQTAGAIC IRSLGASKPS LVYFLTIDNA KFRKPVVPGD QLKIHVKKIK       120
     KRGNLLKFAC EALVDGTKAA EAEISAMMVT GD                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page