(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0636

BA000012.MLL0636     Location/Qualifiers
FT   CDS             complement(502725..505109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0636"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48190"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48190"
FT                   /db_xref="GOA:Q98MC3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC3"
FT                   /protein_id="BAB48190.1"
FT                   /translation="MKAASKFLSAASAAALSAALVVPGALAVQFVATSAAEAAVVSRVE
FT                   VSGNQRVDADTIRNYITIKPGKAFSSSDVDAAVKALFGTGLFSDVQINQVGSTLVVKVA
FT                   EYKVVNQVLFQGNKKLKDNALAAAVQLKPRGTFSQATLDSDVEAVKAAYRRIGRDDAGV
FT                   TTQVMELGDNRVNVVFHITEGDRTQIAAINFVGNSAYSSRRLSDVINTKRSSWVSFILR
FT                   DDVYDEDKLRADQELLRRFYYNHGYADFQVVSAVGELDNATNKYTVTITVQEGERYNFG
FT                   DISVESTIPEVDSKSLESVVETHKGDVYNAKDVEDSIIALTEKVAGSGYAFAQVTPRGD
FT                   RNFENHTISVVYTVDQGTKAYIERIEIRGNDRTRDYVIRREFDVSEGDAFNQVLIQRAK
FT                   KRLEDLNYFDKVEISTVPGSQPDQVVLVVDVVEKSTGEFSVGAGYSTGGDSAGPSVEGS
FT                   ITERNFLGRGQFIKLSAGGGKNSRDYSVSFTEPYFLGRRIAAGFDIYKSTREYNNNYDS
FT                   DTVGATVRFGLPITNSITTQLAYNISQEKYKVDNSCGPTDPPNPPGGTCNISQAILDGI
FT                   AESPWIKSSVSLGLVYNTIDDMKNPHEGIYANTTVEVAGVGGDAKFVKITGRGSIYQTL
FT                   SEQLDLVGLISGGAGHVEGYGNDGDLRIFDHFQSTDRMIRGFAYGGIGPVASGTSGDHL
FT                   GGTTYFNASAEAQFPLPVIPESFGLRGAVFADAATLYGNKIADQTLVDQDSTGMKLRAS
FT                   VGVGLMWASPFGPIRIDYAIPVRKEASDDVQEFNFGISTRF"
     MKAASKFLSA ASAAALSAAL VVPGALAVQF VATSAAEAAV VSRVEVSGNQ RVDADTIRNY        60
     ITIKPGKAFS SSDVDAAVKA LFGTGLFSDV QINQVGSTLV VKVAEYKVVN QVLFQGNKKL       120
     KDNALAAAVQ LKPRGTFSQA TLDSDVEAVK AAYRRIGRDD AGVTTQVMEL GDNRVNVVFH       180
     ITEGDRTQIA AINFVGNSAY SSRRLSDVIN TKRSSWVSFI LRDDVYDEDK LRADQELLRR       240
     FYYNHGYADF QVVSAVGELD NATNKYTVTI TVQEGERYNF GDISVESTIP EVDSKSLESV       300
     VETHKGDVYN AKDVEDSIIA LTEKVAGSGY AFAQVTPRGD RNFENHTISV VYTVDQGTKA       360
     YIERIEIRGN DRTRDYVIRR EFDVSEGDAF NQVLIQRAKK RLEDLNYFDK VEISTVPGSQ       420
     PDQVVLVVDV VEKSTGEFSV GAGYSTGGDS AGPSVEGSIT ERNFLGRGQF IKLSAGGGKN       480
     SRDYSVSFTE PYFLGRRIAA GFDIYKSTRE YNNNYDSDTV GATVRFGLPI TNSITTQLAY       540
     NISQEKYKVD NSCGPTDPPN PPGGTCNISQ AILDGIAESP WIKSSVSLGL VYNTIDDMKN       600
     PHEGIYANTT VEVAGVGGDA KFVKITGRGS IYQTLSEQLD LVGLISGGAG HVEGYGNDGD       660
     LRIFDHFQST DRMIRGFAYG GIGPVASGTS GDHLGGTTYF NASAEAQFPL PVIPESFGLR       720
     GAVFADAATL YGNKIADQTL VDQDSTGMKL RASVGVGLMW ASPFGPIRID YAIPVRKEAS       780
     DDVQEFNFGI STRF                                                         794
//

If you have problems or comments...

PBIL Back to PBIL home page