(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0651

BA000012.MLL0651     Location/Qualifiers
FT   CDS             complement(513472..514254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0651"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48201"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48201"
FT                   /db_xref="GOA:Q98MB2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MB2"
FT                   /protein_id="BAB48201.1"
FT                   /translation="MALPDFSMRQLLEAGIHFGHQTHRWNPKMAPYIYGARNNIHIIDL
FT                   SQTVPLLHQALKQVSDTVAKGGRVLFVGTKRQASDIVADAAQRSAQYYVNSRWLGGMLT
FT                   NWKTISNSIQRLRKLDEMLAGEAQGLTKKERLNLDREREKLDKALGGIKDMGSTPDLMF
FT                   VIDTNKEAIAILEAKRLGIPVVAIIDSNCDPDKIDFPIPGNDDAARAIQLYCDLIAKAA
FT                   IDGIARQQGALGVDIGASVEAPVEPALDPAPSTEAPQA"
     MALPDFSMRQ LLEAGIHFGH QTHRWNPKMA PYIYGARNNI HIIDLSQTVP LLHQALKQVS        60
     DTVAKGGRVL FVGTKRQASD IVADAAQRSA QYYVNSRWLG GMLTNWKTIS NSIQRLRKLD       120
     EMLAGEAQGL TKKERLNLDR EREKLDKALG GIKDMGSTPD LMFVIDTNKE AIAILEAKRL       180
     GIPVVAIIDS NCDPDKIDFP IPGNDDAARA IQLYCDLIAK AAIDGIARQQ GALGVDIGAS       240
     VEAPVEPALD PAPSTEAPQA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page