(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0665

BA000012.MLL0665     Location/Qualifiers
FT   CDS             complement(522590..522919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0665"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48211"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48211"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA2"
FT                   /protein_id="BAB48211.1"
FT                   /translation="MTQTYEDFSKYGKEFADTGLKSFASLSKGAQAIATEAGEYTKKSF
FT                   EAGSAAVEKLFSAKSLDKAIEIQTDYAKQSYEAFVAEATKIGDLYAELAKEAYKPFESI
FT                   VAKAK"
     MTQTYEDFSK YGKEFADTGL KSFASLSKGA QAIATEAGEY TKKSFEAGSA AVEKLFSAKS        60
     LDKAIEIQTD YAKQSYEAFV AEATKIGDLY AELAKEAYKP FESIVAKAK                   109
//

If you have problems or comments...

PBIL Back to PBIL home page