(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0669

BA000012.MLL0669     Location/Qualifiers
FT   CDS             complement(525686..526123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0669"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48214"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48214"
FT                   /db_xref="InterPro:IPR008320"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M99"
FT                   /protein_id="BAB48214.1"
FT                   /translation="MALNLLKLCVGCDSVEDLEEWIEFRLDERRRAGEPAEHWHTTRMV
FT                   PTRGAEITDGGSLYWVIKGNVQCRQLITEIRPFTDDEGIGRCHLMLDPHVVRTDWQPRR
FT                   AFQGWRYLKPSDAPPDLGKGKAGMVEMPPKLRRELADLGLL"
     MALNLLKLCV GCDSVEDLEE WIEFRLDERR RAGEPAEHWH TTRMVPTRGA EITDGGSLYW        60
     VIKGNVQCRQ LITEIRPFTD DEGIGRCHLM LDPHVVRTDW QPRRAFQGWR YLKPSDAPPD       120
     LGKGKAGMVE MPPKLRRELA DLGLL                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page