(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0679

BA000012.MLL0679     Location/Qualifiers
FT   CDS             complement(531729..532121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0679"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48221"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48221"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M92"
FT                   /protein_id="BAB48221.1"
FT                   /translation="MSMFVAASPALAADDFIEGVYLQSEELCTQARKDTLQTLIDAGNI
FT                   VLSVHGLQGVEYNCEFVQVSKATRSPSWAVTAICQEPGYVFPDVLSMTRISPTQLDLVS
FT                   VRPIDDESEASGNSGSYYLCEGVALP"
     MSMFVAASPA LAADDFIEGV YLQSEELCTQ ARKDTLQTLI DAGNIVLSVH GLQGVEYNCE        60
     FVQVSKATRS PSWAVTAICQ EPGYVFPDVL SMTRISPTQL DLVSVRPIDD ESEASGNSGS       120
     YYLCEGVALP                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page