(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0680

BA000012.MLL0680     Location/Qualifiers
FT   CDS             complement(532170..532877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0680"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48222"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48222"
FT                   /db_xref="GOA:Q98M91"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M91"
FT                   /protein_id="BAB48222.1"
FT                   /translation="MKLTWYGHSAFRIETGDAKILIDPYLIGNPSWTGGWEGPAEGITH
FT                   VLLTHGHSDHISGALEVLGKSGAQLVANFEICMYLVGKGADGSKINPGNIGGTVDCGGF
FT                   TTTFVQALHSSSFGEDGGKNVYLGNPGGLVLHFPEDRTLYHMGDTDIFSDMALINELHE
FT                   PKIGIVPIGDRFTMGGAVAALACRRFFKFDTVVPCHFGTFPMIDPTPEKFEAGLEGSGV
FT                   KVALPKIGETITI"
     MKLTWYGHSA FRIETGDAKI LIDPYLIGNP SWTGGWEGPA EGITHVLLTH GHSDHISGAL        60
     EVLGKSGAQL VANFEICMYL VGKGADGSKI NPGNIGGTVD CGGFTTTFVQ ALHSSSFGED       120
     GGKNVYLGNP GGLVLHFPED RTLYHMGDTD IFSDMALINE LHEPKIGIVP IGDRFTMGGA       180
     VAALACRRFF KFDTVVPCHF GTFPMIDPTP EKFEAGLEGS GVKVALPKIG ETITI            235
//

If you have problems or comments...

PBIL Back to PBIL home page