(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0715

BA000012.MLL0715     Location/Qualifiers
FT   CDS             complement(565597..566388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0715"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48251"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48251"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M62"
FT                   /protein_id="BAB48251.1"
FT                   /translation="MRLKITHRTEYRYDAPVQYLLQRLRLLPVSGQTQTVLSWALKVEG
FT                   AREEVRFTDHYGNDTRLLSVEGDHDFITVEASGEVVTRDTSGVCGSHQGFAPLWLFAQE
FT                   TPLTAIGGGIRKLAEAVGTGTDIERLHRLMAMIGERVAYTPGSTKATTPAEEALALKTG
FT                   VCQDHSHIFAAAARAMGFPSRYVSGYLMMDAVEQAASHAWAEAHVPGLGWVAFDPANGI
FT                   SPDERYVKVATGRDYRDASPVSGIRQGQAEERLAVTVTVEQ"
     MRLKITHRTE YRYDAPVQYL LQRLRLLPVS GQTQTVLSWA LKVEGAREEV RFTDHYGNDT        60
     RLLSVEGDHD FITVEASGEV VTRDTSGVCG SHQGFAPLWL FAQETPLTAI GGGIRKLAEA       120
     VGTGTDIERL HRLMAMIGER VAYTPGSTKA TTPAEEALAL KTGVCQDHSH IFAAAARAMG       180
     FPSRYVSGYL MMDAVEQAAS HAWAEAHVPG LGWVAFDPAN GISPDERYVK VATGRDYRDA       240
     SPVSGIRQGQ AEERLAVTVT VEQ                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page