(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0717

BA000012.MLL0717     Location/Qualifiers
FT   CDS             complement(567429..568865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0717"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48253"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48253"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M60"
FT                   /protein_id="BAB48253.1"
FT                   /translation="MASQGSMRLAAFDEMLPEVSGLRRPYSAYDRWLKEQDPARLTEKM
FT                   QDAERVFRKTGITFAVYGEQEASERLIPFDIVPRIISGNEWRRLTQGIEQRVQALNAFL
FT                   DDIYHRQEILRAGRVPRDLIAKNEAFLPEMIGVRPPAGVYTHIIGVDIVRISEDEFYVL
FT                   EDNARTPSGVSYMLENRETMMQLFPELFQKIKVRPVENYPQLLRQSLAAVRPQSTKGAP
FT                   TIAVLTPGSFNSAYFEHAFLADQMGVQLVEGQDLRVVDGHVAMRTTEGYKQIDVLYRRV
FT                   DDSFLDPLTFRPDSALGIPGIMDVYRAGNITIANAPGTGIADDKAIYSYMPEIVEFYTG
FT                   RKAILGNIPTWRCSEPDSLKYVLEHIHELVIKEVHGSGGYGMLVGPAATKKECEAFAKK
FT                   LAAKPSNYIAQPTLALSTCPILTDKGLAPRHVDLRPYVLVSDRIQIVPGGLTRVALKEG
FT                   SLVVNSSQGGGTKDTWVLDD"
     MASQGSMRLA AFDEMLPEVS GLRRPYSAYD RWLKEQDPAR LTEKMQDAER VFRKTGITFA        60
     VYGEQEASER LIPFDIVPRI ISGNEWRRLT QGIEQRVQAL NAFLDDIYHR QEILRAGRVP       120
     RDLIAKNEAF LPEMIGVRPP AGVYTHIIGV DIVRISEDEF YVLEDNARTP SGVSYMLENR       180
     ETMMQLFPEL FQKIKVRPVE NYPQLLRQSL AAVRPQSTKG APTIAVLTPG SFNSAYFEHA       240
     FLADQMGVQL VEGQDLRVVD GHVAMRTTEG YKQIDVLYRR VDDSFLDPLT FRPDSALGIP       300
     GIMDVYRAGN ITIANAPGTG IADDKAIYSY MPEIVEFYTG RKAILGNIPT WRCSEPDSLK       360
     YVLEHIHELV IKEVHGSGGY GMLVGPAATK KECEAFAKKL AAKPSNYIAQ PTLALSTCPI       420
     LTDKGLAPRH VDLRPYVLVS DRIQIVPGGL TRVALKEGSL VVNSSQGGGT KDTWVLDD         478
//

If you have problems or comments...

PBIL Back to PBIL home page