(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0762

BA000012.MLL0762     Location/Qualifiers
FT   CDS             complement(598564..599874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0762"
FT                   /product="urea/short-chain amide ABC transporter,
FT                   periplasmic urea/short-chain amide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48286"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48286"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M27"
FT                   /protein_id="BAB48286.1"
FT                   /translation="MRGNFSTITKMFSASVVAAGLLMSAPARAADDTIKVGILHSLSGT
FT                   MAISETTLKDAMLMLIDEQNAKGGLLGKKLEAVVVDPASNWPLFAEKARELISKDKVAA
FT                   VFGCWTSVSRKSVLPVFSELDNILFYPVQYEGEESERNVFYTGAAPNQQAIPAVDYLMS
FT                   KDGGSVKRWVLEGTDYVYPRTTNKILEAYLKSKGVAAEDIMTNYTPFGFSDWQTEVSAI
FT                   KKFGSAGKKTAVVSTVNGDANVPFYKELGNQGIKAEDIPVMAFSVGEEELAGLDTKPLV
FT                   GHLAAWNYFESVNTPENKKFIANWHKFIKNNKRTTNDPMEAHYIGFNMWVKAVEKAGTT
FT                   DPDKVIDAMIGVSVPNLTGGYSTMMPNHHITKPVLIGEIQANGQFETVSKTPGLVMGDE
FT                   WSDYLPDSKDLISDWRAPLSCGNFNVKTGKCGGKGTN"
     MRGNFSTITK MFSASVVAAG LLMSAPARAA DDTIKVGILH SLSGTMAISE TTLKDAMLML        60
     IDEQNAKGGL LGKKLEAVVV DPASNWPLFA EKARELISKD KVAAVFGCWT SVSRKSVLPV       120
     FSELDNILFY PVQYEGEESE RNVFYTGAAP NQQAIPAVDY LMSKDGGSVK RWVLEGTDYV       180
     YPRTTNKILE AYLKSKGVAA EDIMTNYTPF GFSDWQTEVS AIKKFGSAGK KTAVVSTVNG       240
     DANVPFYKEL GNQGIKAEDI PVMAFSVGEE ELAGLDTKPL VGHLAAWNYF ESVNTPENKK       300
     FIANWHKFIK NNKRTTNDPM EAHYIGFNMW VKAVEKAGTT DPDKVIDAMI GVSVPNLTGG       360
     YSTMMPNHHI TKPVLIGEIQ ANGQFETVSK TPGLVMGDEW SDYLPDSKDL ISDWRAPLSC       420
     GNFNVKTGKC GGKGTN                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page