(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0767

BA000012.MLL0767     Location/Qualifiers
FT   CDS             complement(603499..606195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0767"
FT                   /product="sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48290"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48290"
FT                   /db_xref="GOA:Q98M23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M23"
FT                   /protein_id="BAB48290.1"
FT                   /translation="MRRASGPCFHARRLPKTEVTFGRHALGAGVGTSDFTSRGHMAKEA
FT                   RGDFYPVPIVDQNTRPGAVTRLIIFIVVLTGAAIVFGLFRERLGDPFLLGMLGVLAMIG
FT                   VGFLFATAIGFVQVTPRSTGDELSKAFVDSMAQGLLVTDTKGRVVYANRAYADMTGASS
FT                   AADLKTVEGLLSDVPEASVTIYRLASGLRDGQPGDGEFRLAQSIRPGAEPGARWYRARA
FT                   RTFNVPGQRLPMLAWQLADISQERAEQERFFLDLQKAIDHLDHAPAGFFSADQDGRVTY
FT                   INATLAEWLGIDLASFTPGAVTLPDIVAGDGMALVRSVKADPGTTRNAVIDLDLTTMTG
FT                   EALPVRFMHRVSASREGIGGPTRTIVLNRTQGEDASADLRASEVRFTRFFNSTPMAIAG
FT                   VDASGRILRTNAPFLSLFSSVVDRDAVDRRVRLDTVIHERERPAFAAAFEKARQRQADI
FT                   EPIDTVLPGNEERHIRFYVNAVADGTGGEGAEESAIVYAVETTEQKALEGQMAQSQKMQ
FT                   AVGQLAGGIAHDFNNVLTAIIMASDLLLTNHRPSDPSFPDIMNIKQNANRAASLVRQLL
FT                   AFSRKQTLRPEVLNLTDVLADLRMLLARLVGNDIKLKIDHGRDLWPVKVDIGQFEQVVV
FT                   NLAVNARDAMPAGGDLTVRTRNVTAEECKTFSYRELAAADYVVVEVEDTGSGIAPDVLK
FT                   KIFEPFFTTKEVGKGTGLGLSMVYGIIKQTGGFIFCDSEVGKGSTFRIFLPRHIAEAKK
FT                   GAEPGDAPSAAPVKPVDSTKDLSGSATVLLVEDEDAVRMGGMRALTSRGYTVHEASSGV
FT                   EALEVFEALGGKVDIVVSDVVMPEMDGPTLLGELRKRQPDIKFVFVSGYAEDAFARNLP
FT                   ADAHFGFLPKPFSLKQLATIVKDMLES"
     MRRASGPCFH ARRLPKTEVT FGRHALGAGV GTSDFTSRGH MAKEARGDFY PVPIVDQNTR        60
     PGAVTRLIIF IVVLTGAAIV FGLFRERLGD PFLLGMLGVL AMIGVGFLFA TAIGFVQVTP       120
     RSTGDELSKA FVDSMAQGLL VTDTKGRVVY ANRAYADMTG ASSAADLKTV EGLLSDVPEA       180
     SVTIYRLASG LRDGQPGDGE FRLAQSIRPG AEPGARWYRA RARTFNVPGQ RLPMLAWQLA       240
     DISQERAEQE RFFLDLQKAI DHLDHAPAGF FSADQDGRVT YINATLAEWL GIDLASFTPG       300
     AVTLPDIVAG DGMALVRSVK ADPGTTRNAV IDLDLTTMTG EALPVRFMHR VSASREGIGG       360
     PTRTIVLNRT QGEDASADLR ASEVRFTRFF NSTPMAIAGV DASGRILRTN APFLSLFSSV       420
     VDRDAVDRRV RLDTVIHERE RPAFAAAFEK ARQRQADIEP IDTVLPGNEE RHIRFYVNAV       480
     ADGTGGEGAE ESAIVYAVET TEQKALEGQM AQSQKMQAVG QLAGGIAHDF NNVLTAIIMA       540
     SDLLLTNHRP SDPSFPDIMN IKQNANRAAS LVRQLLAFSR KQTLRPEVLN LTDVLADLRM       600
     LLARLVGNDI KLKIDHGRDL WPVKVDIGQF EQVVVNLAVN ARDAMPAGGD LTVRTRNVTA       660
     EECKTFSYRE LAAADYVVVE VEDTGSGIAP DVLKKIFEPF FTTKEVGKGT GLGLSMVYGI       720
     IKQTGGFIFC DSEVGKGSTF RIFLPRHIAE AKKGAEPGDA PSAAPVKPVD STKDLSGSAT       780
     VLLVEDEDAV RMGGMRALTS RGYTVHEASS GVEALEVFEA LGGKVDIVVS DVVMPEMDGP       840
     TLLGELRKRQ PDIKFVFVSG YAEDAFARNL PADAHFGFLP KPFSLKQLAT IVKDMLES         898
//

If you have problems or comments...

PBIL Back to PBIL home page