(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0798

BA000012.MLL0798     Location/Qualifiers
FT   CDS             complement(630916..632289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0798"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48312"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48312"
FT                   /db_xref="GOA:Q98M01"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M01"
FT                   /protein_id="BAB48312.1"
FT                   /translation="METRANYVIVGIFTLVAILAAFGFVYWTAAIGDRGETTLLRVRIP
FT                   GSASGLGRGSFVLFNGVKVGDVKRVYIDVDNPTVAIADTEIDRLTPITKSTQADIGLAG
FT                   LTGQANIELKGADPKEVKLLDQAEKEGKVAEIVANPSAVTNLLQTAQNIFSRADKVLSE
FT                   LEGFTRDVRGPLTQTVQNVQTFSDALAKNSDGIDKFLSSVSALSEELKGVSGKLDGTLK
FT                   AAEGLLNAVDRDKIKSIVANVDTVTANLKQTSQQLDGVIKNVDTAVGSVNDFAKQTQGT
FT                   LAKVDGVLDGVDPAQVRAALANIQKASENANKAAADIAVVTEKFANRADDIDQTIKDAK
FT                   QLAQRLNDASVRVDGILARVDTLLGSGQADGLMADARDTLKSFKQVADTLNARLGVITD
FT                   NLARFSGQGLSNVEALVQDSRRSITRIEEAVTDLSRNPQRILSGGDGEVRQFDGRARR"
     METRANYVIV GIFTLVAILA AFGFVYWTAA IGDRGETTLL RVRIPGSASG LGRGSFVLFN        60
     GVKVGDVKRV YIDVDNPTVA IADTEIDRLT PITKSTQADI GLAGLTGQAN IELKGADPKE       120
     VKLLDQAEKE GKVAEIVANP SAVTNLLQTA QNIFSRADKV LSELEGFTRD VRGPLTQTVQ       180
     NVQTFSDALA KNSDGIDKFL SSVSALSEEL KGVSGKLDGT LKAAEGLLNA VDRDKIKSIV       240
     ANVDTVTANL KQTSQQLDGV IKNVDTAVGS VNDFAKQTQG TLAKVDGVLD GVDPAQVRAA       300
     LANIQKASEN ANKAAADIAV VTEKFANRAD DIDQTIKDAK QLAQRLNDAS VRVDGILARV       360
     DTLLGSGQAD GLMADARDTL KSFKQVADTL NARLGVITDN LARFSGQGLS NVEALVQDSR       420
     RSITRIEEAV TDLSRNPQRI LSGGDGEVRQ FDGRARR                                457
//

If you have problems or comments...

PBIL Back to PBIL home page