(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0820

BA000012.MLL0820     Location/Qualifiers
FT   CDS             complement(650427..651143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0820"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48327"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48327"
FT                   /db_xref="GOA:Q98LY6"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY6"
FT                   /protein_id="BAB48327.1"
FT                   /translation="MADFQKIRLRAAKRKGGEAELATLLGPVPDNAAVADIPDDRILST
FT                   MAERIFAAGFVWRVIEQKWPGFEEAFLRFEPKRLLFQPDDFWHDLTSDQRIVRNPQKIK
FT                   SVRDNAAFVERVSKEHGGFGEFLANWPAGDQVGLMAYLGKHGSRLGGNTGQYFLRWLGW
FT                   DAFVISADMAAALCDAGLDIAESPTSKKDLDKIQAQINQWVADTGLPRRHISRILAMSI
FT                   GENHSPQSLREYMGDD"
     MADFQKIRLR AAKRKGGEAE LATLLGPVPD NAAVADIPDD RILSTMAERI FAAGFVWRVI        60
     EQKWPGFEEA FLRFEPKRLL FQPDDFWHDL TSDQRIVRNP QKIKSVRDNA AFVERVSKEH       120
     GGFGEFLANW PAGDQVGLMA YLGKHGSRLG GNTGQYFLRW LGWDAFVISA DMAAALCDAG       180
     LDIAESPTSK KDLDKIQAQI NQWVADTGLP RRHISRILAM SIGENHSPQS LREYMGDD         238
//

If you have problems or comments...

PBIL Back to PBIL home page