(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0849

BA000012.MLL0849     Location/Qualifiers
FT   CDS             complement(677824..678891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0849"
FT                   /product="ATP-binding protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48350"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48350"
FT                   /db_xref="GOA:Q98LW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW3"
FT                   /protein_id="BAB48350.1"
FT                   /translation="MASVTLDKVRKDYGAVRVLHAVDLEIADGEFVVLVGPSGCGKSTL
FT                   LRMIAGLEEASGGEIRIGERLVNDVAPKDRDIAMVFQSYALYPHMDVSKNMGFSLLLKK
FT                   AQKSTIDARVDGAAKRLGLDTFLQRLPRQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVHMRAEIKALHQQLKTTSVYVTHDQIEAMTMADRIVVMHDGLIQQVGAPLDLY
FT                   DRPANVFVAGFIGSPGMNFLPATVEKGAKADAVLSDGQKLRLPDGLPLKDGDAITIGLR
FT                   PEHIRLAEDGALQGEVVVVEPLGLSTQFYVTLANQQLCVFAMGRAGVKPGDIVRLAADP
FT                   AALHLFDPKSGDRIG"
     MASVTLDKVR KDYGAVRVLH AVDLEIADGE FVVLVGPSGC GKSTLLRMIA GLEEASGGEI        60
     RIGERLVNDV APKDRDIAMV FQSYALYPHM DVSKNMGFSL LLKKAQKSTI DARVDGAAKR       120
     LGLDTFLQRL PRQLSGGQRQ RVAMGRAIVR DPKVFLFDEP LSNLDAKLRV HMRAEIKALH       180
     QQLKTTSVYV THDQIEAMTM ADRIVVMHDG LIQQVGAPLD LYDRPANVFV AGFIGSPGMN       240
     FLPATVEKGA KADAVLSDGQ KLRLPDGLPL KDGDAITIGL RPEHIRLAED GALQGEVVVV       300
     EPLGLSTQFY VTLANQQLCV FAMGRAGVKP GDIVRLAADP AALHLFDPKS GDRIG            355
//

If you have problems or comments...

PBIL Back to PBIL home page