(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0865

BA000012.MLL0865     Location/Qualifiers
FT   CDS             complement(689256..690923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0865"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48361"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48361"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV2"
FT                   /protein_id="BAB48361.1"
FT                   /translation="MMVFAYQKYETIFAFSIQRRLPVNRMLPVAFTALLFSAPAFGQAV
FT                   DSQGAKQLSDDLSRYVGKQAFDKGILKVSVEGGAYKIAFDVKALAATFPEQGKVKLDFA
FT                   PYALLVKPRSDGTWDVSIDFSQSGSFEFTGPEGLQSTQFSIKDGKGSGVYDPNLAAFIS
FT                   GTSSLAGMTMASKDAKQQMEASTGAGTATIAATKAANGGVDFTMSQKISNFVEAIKLDD
FT                   PENGLNFPVTIKSPELSVEASGKGVQTRPLLDLLAFAVANEDEKTLEANQAQLKSLLRA
FT                   ALPVWERIDGTYGFKDFAVDSPIGTFGATQLSTVFGSDGVSQSGKVTYGIKASGLTVPQ
FT                   QLLPSWSVALLPTDIDLNFGGANIDLDSMAKKAIEAFDLNQDPPLSAEFGDQLKADFLA
FT                   KAPKVMIGHSVVKNKDMEIALEGEMTSFGQKPDANLTVDVAGFDKIMAHLQEAAKAEPE
FT                   VGQYVPVALMAKGFAKTLPDGRLEWAVSTKADGSVTVNGVMLKPADPAVDDGGDGGDGG
FT                   DGADDSSGGDNGGGANSGGGDANGGSSDNGGAGAKLNP"
     MMVFAYQKYE TIFAFSIQRR LPVNRMLPVA FTALLFSAPA FGQAVDSQGA KQLSDDLSRY        60
     VGKQAFDKGI LKVSVEGGAY KIAFDVKALA ATFPEQGKVK LDFAPYALLV KPRSDGTWDV       120
     SIDFSQSGSF EFTGPEGLQS TQFSIKDGKG SGVYDPNLAA FISGTSSLAG MTMASKDAKQ       180
     QMEASTGAGT ATIAATKAAN GGVDFTMSQK ISNFVEAIKL DDPENGLNFP VTIKSPELSV       240
     EASGKGVQTR PLLDLLAFAV ANEDEKTLEA NQAQLKSLLR AALPVWERID GTYGFKDFAV       300
     DSPIGTFGAT QLSTVFGSDG VSQSGKVTYG IKASGLTVPQ QLLPSWSVAL LPTDIDLNFG       360
     GANIDLDSMA KKAIEAFDLN QDPPLSAEFG DQLKADFLAK APKVMIGHSV VKNKDMEIAL       420
     EGEMTSFGQK PDANLTVDVA GFDKIMAHLQ EAAKAEPEVG QYVPVALMAK GFAKTLPDGR       480
     LEWAVSTKAD GSVTVNGVML KPADPAVDDG GDGGDGGDGA DDSSGGDNGG GANSGGGDAN       540
     GGSSDNGGAG AKLNP                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page