(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0867

BA000012.MLL0867     Location/Qualifiers
FT   CDS             complement(692960..693466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0867"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48363"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48363"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV0"
FT                   /protein_id="BAB48363.1"
FT                   /translation="MRPFAQFALAGCLLVAAGTAHADETKFLQSFKGNFAGKGTVQVTS
FT                   DVPNVNVSCSFKSNATSTSLSLDGSCRGLILVTRAISAKLNVTGAKYSGVYVGSRTGPA
FT                   QLNGSRSGNAINLGIQWAQEINGDRKARMTVEKRGENGIRLTVTDTDPKTGKNVVMSRI
FT                   DLSRT"
     MRPFAQFALA GCLLVAAGTA HADETKFLQS FKGNFAGKGT VQVTSDVPNV NVSCSFKSNA        60
     TSTSLSLDGS CRGLILVTRA ISAKLNVTGA KYSGVYVGSR TGPAQLNGSR SGNAINLGIQ       120
     WAQEINGDRK ARMTVEKRGE NGIRLTVTDT DPKTGKNVVM SRIDLSRT                    168
//

If you have problems or comments...

PBIL Back to PBIL home page