(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0880

BA000012.MLL0880     Location/Qualifiers
FT   CDS             complement(706411..707412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0880"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48374"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48374"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT9"
FT                   /protein_id="BAB48374.1"
FT                   /translation="MGELIMSAPVAGLTSKNRIAAEDVLMLRRDVFADGVVTRGEAEAL
FT                   FALDQTAQDKCAEWAPFFVEAVTDYIVHQEKPSGYISQDNADWLVRTISRDGMVDSRTE
FT                   LELLVHVLEKARSSPSKLCVYALEQVAHAVIDGKGPLMLGGALVPGLIAKAEVELLRRI
FT                   LYAHGGDGNIAITRGEAEVLFRINEQTAQAKNDPSWNDLFVKAIANFVMCSAGYEAPTR
FT                   DVALRQESFLEHAEPEIGGFFSRMVSGGLAGIIEAYRSPDDIEAEWEAKNRAAEALARR
FT                   AETIDAGEAKWLIEHIGTNRPLYENERALLTLIKHASPEIHPALRPLLDKVA"
     MGELIMSAPV AGLTSKNRIA AEDVLMLRRD VFADGVVTRG EAEALFALDQ TAQDKCAEWA        60
     PFFVEAVTDY IVHQEKPSGY ISQDNADWLV RTISRDGMVD SRTELELLVH VLEKARSSPS       120
     KLCVYALEQV AHAVIDGKGP LMLGGALVPG LIAKAEVELL RRILYAHGGD GNIAITRGEA       180
     EVLFRINEQT AQAKNDPSWN DLFVKAIANF VMCSAGYEAP TRDVALRQES FLEHAEPEIG       240
     GFFSRMVSGG LAGIIEAYRS PDDIEAEWEA KNRAAEALAR RAETIDAGEA KWLIEHIGTN       300
     RPLYENERAL LTLIKHASPE IHPALRPLLD KVA                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page