(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0893

BA000012.MLL0893     Location/Qualifiers
FT   CDS             complement(716919..717836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0893"
FT                   /product="probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48382"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48382"
FT                   /db_xref="GOA:Q98LT1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT1"
FT                   /protein_id="BAB48382.1"
FT                   /translation="MPVAILLLVLGSVAVAWPMVAAKGDRNDVKRRLKVDHGAMAAKPE
FT                   PPQKKNANVVRERAVKRAQEFYAKSDPENVARLRMKLIQAGYMEPRAVGTFFIIRFSAL
FT                   VGGAIGAFVLNQWLASAEATMTSRWAFVILSGVAGYFLPGLVLTQQVREKMREYRNGFP
FT                   DFMDLMIVCSDAGMSMEAGIERVSKELAKTYPALSQNLQLVSLELRAGRSLDDALKALA
FT                   DRLSLDEVRSFATLLQQSKELGTSLSGALRVFSDEMRHKRMSLAEEKAHALPAKMSIPV
FT                   TVCILPVVLMIAIIPIIVKMTGSH"
     MPVAILLLVL GSVAVAWPMV AAKGDRNDVK RRLKVDHGAM AAKPEPPQKK NANVVRERAV        60
     KRAQEFYAKS DPENVARLRM KLIQAGYMEP RAVGTFFIIR FSALVGGAIG AFVLNQWLAS       120
     AEATMTSRWA FVILSGVAGY FLPGLVLTQQ VREKMREYRN GFPDFMDLMI VCSDAGMSME       180
     AGIERVSKEL AKTYPALSQN LQLVSLELRA GRSLDDALKA LADRLSLDEV RSFATLLQQS       240
     KELGTSLSGA LRVFSDEMRH KRMSLAEEKA HALPAKMSIP VTVCILPVVL MIAIIPIIVK       300
     MTGSH                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page