(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0899

BA000012.MLL0899     Location/Qualifiers
FT   CDS             complement(721798..723183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0899"
FT                   /product="probable secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48387"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48387"
FT                   /db_xref="GOA:Q98LS6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS6"
FT                   /protein_id="BAB48387.1"
FT                   /translation="MAAALVAGAMLALPGVAKADNDIVYVSATKNASIKVAKGKPKTIV
FT                   TNAAFYQIVIGDPEIANVNPLTDKSFYVLGNNLGTTGIALFDEKKQLVGTVDIEVTLDT
FT                   DQLASTIRASVPDAKIKVGSANGRVVLSGEADDAVAAEKANKIATRFSGTEEVINSVNI
FT                   SSSQQVQLNVRFVEINRQAGQDLGAKYSANFAYGFGGRDVSLDPGTVPAAGTGEIIGRL
FT                   LSNGVSIDIAIKALEERGLARRLAEPNLIARSGETASFLAGGEFPIPVSEDNGKISVSY
FT                   KKYGVSLDFTPTVLKDGLVSLDIAPEVSSIDASSSYNIGTISVPGFIVRRAKTSVDLKN
FT                   GQSFMIAGLLQSQNDITTSRIPGLGKMPVLGALFSSKSYQRRETDLVIIVTPYLVKPVD
FT                   PSKKMVEPTDGTRPASNVDYFLNNTEEVKASDAGRALALADGSAARTAPTTTVGHFLDL
FT                   PKD"
     MAAALVAGAM LALPGVAKAD NDIVYVSATK NASIKVAKGK PKTIVTNAAF YQIVIGDPEI        60
     ANVNPLTDKS FYVLGNNLGT TGIALFDEKK QLVGTVDIEV TLDTDQLAST IRASVPDAKI       120
     KVGSANGRVV LSGEADDAVA AEKANKIATR FSGTEEVINS VNISSSQQVQ LNVRFVEINR       180
     QAGQDLGAKY SANFAYGFGG RDVSLDPGTV PAAGTGEIIG RLLSNGVSID IAIKALEERG       240
     LARRLAEPNL IARSGETASF LAGGEFPIPV SEDNGKISVS YKKYGVSLDF TPTVLKDGLV       300
     SLDIAPEVSS IDASSSYNIG TISVPGFIVR RAKTSVDLKN GQSFMIAGLL QSQNDITTSR       360
     IPGLGKMPVL GALFSSKSYQ RRETDLVIIV TPYLVKPVDP SKKMVEPTDG TRPASNVDYF       420
     LNNTEEVKAS DAGRALALAD GSAARTAPTT TVGHFLDLPK D                           461
//

If you have problems or comments...

PBIL Back to PBIL home page