(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0900

BA000012.MLL0900     Location/Qualifiers
FT   CDS             complement(723274..724200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0900"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48388"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48388"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS5"
FT                   /protein_id="BAB48388.1"
FT                   /translation="MRGKAITMIGIAAVFGAISIFAADFWVKSQAKADAEEKTASIAAP
FT                   VPPRIEFKTIVVAKAPLRYGQELDRAKLIEIPWPQDSLPQGAFATIDGLLGEGNRIVLS
FT                   PIEVNEPVLLTKLSGPNGRATLSNMLTPGMRAVTIRTDEIAGVGGFVTPGDRVDVVLTR
FT                   DAGEIQEVAKNAQGAAGSTVTSEIVVADAKVLSVGQGADERQTTPQITNSVTIEVTTEG
FT                   AQKVALARTVGTLSLSLRSASEGGDGKNGVTTISSFGGSVAAKAQAAAGSLFDAITKEP
FT                   EKPKFKTVIVTRGTKAEEYQVPERDQK"
     MRGKAITMIG IAAVFGAISI FAADFWVKSQ AKADAEEKTA SIAAPVPPRI EFKTIVVAKA        60
     PLRYGQELDR AKLIEIPWPQ DSLPQGAFAT IDGLLGEGNR IVLSPIEVNE PVLLTKLSGP       120
     NGRATLSNML TPGMRAVTIR TDEIAGVGGF VTPGDRVDVV LTRDAGEIQE VAKNAQGAAG       180
     STVTSEIVVA DAKVLSVGQG ADERQTTPQI TNSVTIEVTT EGAQKVALAR TVGTLSLSLR       240
     SASEGGDGKN GVTTISSFGG SVAAKAQAAA GSLFDAITKE PEKPKFKTVI VTRGTKAEEY       300
     QVPERDQK                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page