(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0904

BA000012.MLL0904     Location/Qualifiers
FT   CDS             complement(727485..729701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0904"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48391"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48391"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS2"
FT                   /protein_id="BAB48391.1"
FT                   /translation="MDLYGKSVRARRRGQCAGPGLCQFRIAVRGPLRGGSGADAAARRC
FT                   FVKGAVGDGRSALHEPSRAAADHQRTGLRPARSRRCRAGAFAAAYRCRSDQPRGGESEG
FT                   DAEADRRPSCRLDGAVGGDRRDRRGGSLRGAARQQRRRHRFSELPPHGRTPWASAAGAR
FT                   GADIGHQAACRLPAHAADQARRDVEDIAAGHGIDGRRAGRSRPAGRLRQGLGDTDRGHA
FT                   PGRTCRADRASQAARRPHCELPHPHHRAWQGRFLRLHAGRTRPAVRTAGEGAAGRRPRR
FT                   GLAGIVPQRGPGRGNACDHPACLENLAGGRQWQAHRRRAGSQLADAQGVGRAIRGRRSR
FT                   GPGQVDPSRRAARERAGSRAGHCGGLGFIPREKIGKILHRGGNDAQGCRDLQHVAGGVS
FT                   LGDARRVLPGDSNGGCLRIAGGAEQQFARQPSQEIGDRKCGFGRDGMVLARAAQPQDLQ
FT                   ADRDGGDAAAQHRITLPAGILHQRHQLVDAVIGEAFEGRTPRHALVQAKPCQILAHGPY
FT                   DPVRREPRIGGQHDNEDADRQQNAYQNGRRAGEERARIVGHRLMRAEESEEVDGEGRGY
FT                   ADIARIGHAQRRRHQDRHNEQHEPAEAGQSRQCDLADEKGKGQSQQRALEEAPGHLHRI
FT                   GASGEKAGYDGNENDRARRLGPFRRQPEGRDQQGGKGGTHGIARCAGVVAVHHQRRLPA
FT                   GAAGTCDRRAQGIEPAQHLLERLGEIGGDGEAGDGADPVVTLVD"
     MDLYGKSVRA RRRGQCAGPG LCQFRIAVRG PLRGGSGADA AARRCFVKGA VGDGRSALHE        60
     PSRAAADHQR TGLRPARSRR CRAGAFAAAY RCRSDQPRGG ESEGDAEADR RPSCRLDGAV       120
     GGDRRDRRGG SLRGAARQQR RRHRFSELPP HGRTPWASAA GARGADIGHQ AACRLPAHAA       180
     DQARRDVEDI AAGHGIDGRR AGRSRPAGRL RQGLGDTDRG HAPGRTCRAD RASQAARRPH       240
     CELPHPHHRA WQGRFLRLHA GRTRPAVRTA GEGAAGRRPR RGLAGIVPQR GPGRGNACDH       300
     PACLENLAGG RQWQAHRRRA GSQLADAQGV GRAIRGRRSR GPGQVDPSRR AARERAGSRA       360
     GHCGGLGFIP REKIGKILHR GGNDAQGCRD LQHVAGGVSL GDARRVLPGD SNGGCLRIAG       420
     GAEQQFARQP SQEIGDRKCG FGRDGMVLAR AAQPQDLQAD RDGGDAAAQH RITLPAGILH       480
     QRHQLVDAVI GEAFEGRTPR HALVQAKPCQ ILAHGPYDPV RREPRIGGQH DNEDADRQQN       540
     AYQNGRRAGE ERARIVGHRL MRAEESEEVD GEGRGYADIA RIGHAQRRRH QDRHNEQHEP       600
     AEAGQSRQCD LADEKGKGQS QQRALEEAPG HLHRIGASGE KAGYDGNEND RARRLGPFRR       660
     QPEGRDQQGG KGGTHGIARC AGVVAVHHQR RLPAGAAGTC DRRAQGIEPA QHLLERLGEI       720
     GGDGEAGDGA DPVVTLVD                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page