(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0911

BA000012.MLL0911     Location/Qualifiers
FT   CDS             complement(735453..736037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0911"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48398"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48398"
FT                   /db_xref="GOA:Q98LR5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR5"
FT                   /protein_id="BAB48398.1"
FT                   /translation="MASPIIDFLLTRNSAPIPDLKEPAPNDAEIATMIAAATRVPDHGR
FT                   LEPWRFILYRGDVRIEIGRKLAALAEQREGPLPEGRRNQELARFSRAPLVIGVVSVPKE
FT                   NPKIPQWEMFLSGGMAAMNLIISANALGYGTNMISNWYSDVPEGRAILGLAPQERVVGF
FT                   IHIGSYAGPAPERPRPDPAKLYADYSGSWAD"
     MASPIIDFLL TRNSAPIPDL KEPAPNDAEI ATMIAAATRV PDHGRLEPWR FILYRGDVRI        60
     EIGRKLAALA EQREGPLPEG RRNQELARFS RAPLVIGVVS VPKENPKIPQ WEMFLSGGMA       120
     AMNLIISANA LGYGTNMISN WYSDVPEGRA ILGLAPQERV VGFIHIGSYA GPAPERPRPD       180
     PAKLYADYSG SWAD                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page