(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0913

BA000012.MLL0913     Location/Qualifiers
FT   CDS             complement(737182..738120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0913"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48400"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48400"
FT                   /db_xref="GOA:Q98LR3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR3"
FT                   /protein_id="BAB48400.1"
FT                   /translation="MLKLKTREKPFPELSYANPRQPALTRWVIHSIEGLSGRDRYAVLY
FT                   DFWRRQVVPTGERVFSRMLDLIDVRIRTADQWPPAPLPDTPLVIVANHPFGIGDGIAVL
FT                   SLVEQLGRPFRVMIHKDLLKIREMEPYSLPIDFSETKDALKNNMAVRHEAVRLLKEGVT
FT                   IVVFPAGGVATAPKGFGRARDLPWKMFPARLVQDAKASVIPMHFSGQNGRLFHLVSGPM
FT                   YMAERDGRVAKFVGKASLTLRLSMLIHEFARLSGKAIDVRVGDVLSWSELEPLRDRKAL
FT                   LDRLYRGVFDLAPQVPRRRIPFLPARTKLAA"
     MLKLKTREKP FPELSYANPR QPALTRWVIH SIEGLSGRDR YAVLYDFWRR QVVPTGERVF        60
     SRMLDLIDVR IRTADQWPPA PLPDTPLVIV ANHPFGIGDG IAVLSLVEQL GRPFRVMIHK       120
     DLLKIREMEP YSLPIDFSET KDALKNNMAV RHEAVRLLKE GVTIVVFPAG GVATAPKGFG       180
     RARDLPWKMF PARLVQDAKA SVIPMHFSGQ NGRLFHLVSG PMYMAERDGR VAKFVGKASL       240
     TLRLSMLIHE FARLSGKAID VRVGDVLSWS ELEPLRDRKA LLDRLYRGVF DLAPQVPRRR       300
     IPFLPARTKL AA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page