(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0946

BA000012.MLL0946     Location/Qualifiers
FT   CDS             complement(761374..761853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0946"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48424"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48424"
FT                   /db_xref="GOA:Q98LN9"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN9"
FT                   /protein_id="BAB48424.1"
FT                   /translation="MFGRASHRFAEMAKRPSSSFCRDPRYCAGASAFRRDRSGGAGLEF
FT                   ALIAPFLIILLFGIFALGWSMHSVSSVRYTLETSSRSLQLQNTLTQADIQSIATQKLQA
FT                   LGLKDVNVTIAVDPASGGFRMAHLTATYAFVVDFPYLSSFPINYATTVTVPLVGG"
     MFGRASHRFA EMAKRPSSSF CRDPRYCAGA SAFRRDRSGG AGLEFALIAP FLIILLFGIF        60
     ALGWSMHSVS SVRYTLETSS RSLQLQNTLT QADIQSIATQ KLQALGLKDV NVTIAVDPAS       120
     GGFRMAHLTA TYAFVVDFPY LSSFPINYAT TVTVPLVGG                              159
//

If you have problems or comments...

PBIL Back to PBIL home page