(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0947

BA000012.MLL0947     Location/Qualifiers
FT   CDS             complement(761843..762277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0947"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48425"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48425"
FT                   /db_xref="GOA:Q98LN8"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN8"
FT                   /protein_id="BAB48425.1"
FT                   /translation="MERGSILGDRSGVAAVEFAMVLPFLCAALLGIIDGWSYVTSSLSM
FT                   RAGVKTAANLIMEGSTNDTATQAVAMSSWEKRPTDGQVTLSRIYMCGTTVVDASTLCSG
FT                   PKVPSVYVQIQASATWTPPFTFGVFSASSVIGHLEVIRVR"
     MERGSILGDR SGVAAVEFAM VLPFLCAALL GIIDGWSYVT SSLSMRAGVK TAANLIMEGS        60
     TNDTATQAVA MSSWEKRPTD GQVTLSRIYM CGTTVVDAST LCSGPKVPSV YVQIQASATW       120
     TPPFTFGVFS ASSVIGHLEV IRVR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page