(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0948

BA000012.MLL0948     Location/Qualifiers
FT   CDS             complement(762284..763510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0948"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48426"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48426"
FT                   /db_xref="GOA:Q98LN7"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN7"
FT                   /protein_id="BAB48426.1"
FT                   /translation="MAFNRFTRIRLVATGIRRSTRANVATIFALSLPIVVGAAGFGVET
FT                   SYWYYNSLRLQATADAAAYAGALEQISGSDKPTIIAAATQSAATNGLGSGTIVVNTPPA
FT                   SGPNTAKKAVEVIVAQNINRMFTSIFTQGQVPEQARAVALITNASKACVLALDPSASQA
FT                   ALFSGNTSVKLIGCSVMSNSIASDAIKLQGSAGLQADCLISGGGVSLSNPVTTVCAAPI
FT                   TQALPAADPFADLPAPAASNPCQNDNKATLSPGTYCSGMTLKGNVTLSPGVYVVQGNLK
FT                   INANAAITGSGVTIFMSGSSSVSINGNASVKLSAPTSGAYSGVLFYGDRTGNSASSTFN
FT                   GTADSLLTGAIYFPKQQISYLGNFSGNNGCTQVVANTIQWSGNSTINQDCTSLGMRDIP
FT                   ATQSVALVE"
     MAFNRFTRIR LVATGIRRST RANVATIFAL SLPIVVGAAG FGVETSYWYY NSLRLQATAD        60
     AAAYAGALEQ ISGSDKPTII AAATQSAATN GLGSGTIVVN TPPASGPNTA KKAVEVIVAQ       120
     NINRMFTSIF TQGQVPEQAR AVALITNASK ACVLALDPSA SQAALFSGNT SVKLIGCSVM       180
     SNSIASDAIK LQGSAGLQAD CLISGGGVSL SNPVTTVCAA PITQALPAAD PFADLPAPAA       240
     SNPCQNDNKA TLSPGTYCSG MTLKGNVTLS PGVYVVQGNL KINANAAITG SGVTIFMSGS       300
     SSVSINGNAS VKLSAPTSGA YSGVLFYGDR TGNSASSTFN GTADSLLTGA IYFPKQQISY       360
     LGNFSGNNGC TQVVANTIQW SGNSTINQDC TSLGMRDIPA TQSVALVE                    408
//

If you have problems or comments...

PBIL Back to PBIL home page