(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0950

BA000012.MLL0950     Location/Qualifiers
FT   CDS             complement(763808..774787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0950"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48427"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48427"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN6"
FT                   /protein_id="BAB48427.1"
FT                   /translation="MTLTLFVGSTGPAEATCTGPSGGVETCAGSGTQSDISYTAPGVTT
FT                   LNVNTLTIDPSRISLTGSGANPAPATEVQHYTCSTGNAADCVITPEKPAQNGNPAVAES
FT                   CAVASGAPAGTSCVAPPVKAAGGPSGNSGPTLVVNYNQPTANTNTPNSGAVIATGTIGV
FT                   LGASNGSRGGNGSNGYVFSDGGDGANGADGGIVTVNVDGAVMTSNNCVLPTACPNAGIV
FT                   ASSVGGDGGDGGDAKGISGDAGDGGLGGSGGNATVNFNSGSVETQGNYSAGIAAISQGG
FT                   HGGNGGGGGGLVFNPGGGSPAGAGGNANVFTGVGTTITTYGIYSHGIAAQSIGGGGGGS
FT                   AGGFGLFSSSGGSGGNGGNGGIVQVTNNANIATWGNNSQGILAQTIGGGGGDGGSNFGL
FT                   FASGGSGSLGGNGGPANVVTVGVTNSGAIVTHGQESNGILAQSIGGGGGNGGNSGGLVS
FT                   LGGDGASTTNGGIVEVTNTSAGSISTDGKQSAGIFAQSVGGGGGNGGTSGGLFSAGGKG
FT                   GAGGNGARVTVTNAGDIETGKNGAASVNSAGIFAQSVGGGGGNGGGAFSGGIGFSVAIG
FT                   GAGGSGGTSGAVEVLRDANDTAYSIITHGDQSDAVFAQSIGGGGGNGGFSVSGAVGVLA
FT                   LAMGGAAGNASDGNIVTVETAGSLTTYGQGSRGIFAQSIGGTGGNGGAAIAVAVNATGT
FT                   FAAAIGIGGNGGAGGASKLVTVSSLSDISTAGNNAGGIVAQSVGGGGGNGGYAIGGAIG
FT                   GAVGIAVNIGGKGAGGGAGADVIVGSSGSIHTKGNNSTGILAQSVGGGGGNGGFTISAA
FT                   LGGGAASVGLGGAGADGSNAGNVTVSADGAGHTVATTYTGTWNLVTEGKNAVGIQAESI
FT                   GGGGGNGGFSGSLAAGGLVGVGVSLGGTGGGGGDAGTATVNNGKKVGNTVTHNNILTIE
FT                   DNSTGILAQSIGGGGGNGGFAVTLSVSGSYEGAGGAAAVSVGGSGATGGVGKDVFVTSY
FT                   GNIATYGKQSDGILAQSIGGGGGNGGFSVAGTFTTGALGASVAVGGSGGSGQSAGEVTV
FT                   TSAGNIQTHGDQSIGIMAQSVGGGGGNGGFAGAGAITLQGVSAAVGLGGSGAGGGSAKT
FT                   VRVTSTGDITTYGDQAIGILAQSVGGGGGNGGSTVSLALAKDAGIGVALGGKGGAAGNG
FT                   LDVTVISTGNISTGAGFISGGVRGTGAAGILAQSVGGGGGNGGFAGTLGGGKSIAVGVA
FT                   FGGSGAGGGSADIVKVTSTGNISTNFDNSSGIIAQSIGGGGGNGGFSVAVTGALGDPDA
FT                   ATASVAIGGKGGVGGVGKDVTVTSTGTITTTGKFSNGILAQSIGGGGGNGGFAVAGSAT
FT                   TGNAGIGVGVGGTGATGSASGKVIVNSYSLVGANGQPVLLAPASNIVSIWTQGDNSSGI
FT                   FAQSVGGGGGSGGFAGSLGVGLGGGGLGVSIGGGAGSGSTAETVTVTSYNNILTGGKDS
FT                   FGIMAQSVGGGGGNGGFAIALAGSKDMAASVAVGGSGSSGGDAAVVTVTSHGNIETDGD
FT                   GSHAIFAQSVGGGGGNGGGAIAGTLTGEGTGSLAVGVGGSGDNGGNAKAVTVSSTGDLR
FT                   TEGLKADGILAQSIGGGGGNGGFSGALAITTGAGAIGVGVGGSGKGGGNADTVTVTSTG
FT                   NIVTLKNGSNGILAQSVGGGGGNGGAAVTIAGSGQKAAAAVSVGGSGAKGGTSQLVTVN
FT                   NIGTIDTTGDKANGILAQSIGGGGGTGGFAISGEMVVDGAGGAAVSVGGNGGTGQDGGR
FT                   VIVNSNIGTTLANNNATIHTVGGDSNGIFAQSVGGGGGDGGFSGAVSVTGQNAKAAIGV
FT                   SVGGSGAGSGDGKTVNVTSVDNILTGGNGANGILAQSVGGGGGNGGFSFAATIKGSLGK
FT                   NPSKNGAVSVSLGGGAGSGGDAEKVTVDSTGIIQTSGNKAFGVLAQSVGGGGGTGGLSV
FT                   AAALNLGEGGNQITAAVGGEGGGGGTGGEVLLTRHGSTITTGDQSVGLFAQSVGGSGGN
FT                   GGMAISGVIAGTDAKTLSASVGGFGGAGTNASKVTVDNTGAISTYGVESDAIQAQSIGG
FT                   GGGNGGMAVSAVIGSLGTGTNFNAGVTVGGFGGDAGFAGDVFVTNHGLLQTGLLAAGQT
FT                   TTNGDGAYGIFAQSVGGGGGSGGNAITGVLGLKGNNAGTQVNVSVAVGGSAGNGNTGGN
FT                   VTIRQYGGIETNGMGAFGILAQSIGGGGGTGGRANSISLQLGAKCTLPKVCEPAGGKPN
FT                   WNLQATVGGAGGTGNDAMTVDVGNYDFITTDGDKSSGIVAQSIGGGGGIGGDAYVGTGG
FT                   LLAIPYVPVDPTLLLKPLGTSSLTRSGTVAIGGNGAGGGNGGTVIVANEGVITTHGTKS
FT                   DGIHAQSIGGGGGDGGDGEAGALGTVGLGGQGKAAGNGGSVTVTNGKANLSQAGAAIIQ
FT                   TFGTSPTPPAEGAPSADPEQGYSAGIFAQSVGGGGGTGGGAGGLLSLGGSGKAGGTGGH
FT                   VTVNNYGGILTHADDSVGIFAQSIGGGGGAGGSLGISAIAVGGSGGASGSGGQVDVVNN
FT                   AMIETHGIDSYAIQAQSVGGGGGSGGGKNGGITGSIPALISIGGAGGSSGIGGIVNVTN
FT                   NNSLHTYGAGADGINAQSIGGGGGSGGRAIGFIAVGGKGGDVGNGTTAGSNGGGGAVTV
FT                   NNNANGTITVEGIGAHGIFAQSVGAGGGSGGGAFGVSIVPVAIGVGGGGGSSGDGGVVT
FT                   VNNHGDITTVSASSVAIFAESIGGGGGTGAMSVAASPAPGAFTFGIGGDGGANGKGGNV
FT                   NVTNFSDGIIHTQGFGSTGIMAQSVGGGGGAGGASYSVSGGPPGLAIALGGKGAAGGDG
FT                   GIVTVINNGAMQLDGDNSVAIFAQSVGGGGGSGGTAIAAAIGVPVFIGGDTGATGKGGD
FT                   VTVTNTGQIRLTGNGSVGIFAQSVGGGGGVVTAGTDGIVQAVAGGSGNGGVVTINSNVA
FT                   MLITGDNSVGVFGQSIGGGGGVGGFSGNYLGLDQVQSTSSKMAMAPQGFMGSAGGGGTG
FT                   GAITFTQTADLAVIGKNSFALMEQSAGGTGNISDNGDINVTIASGVTIIGGSGAGGGIG
FT                   YKDGKDNVLTNNGIVRSVLLIDGYAMRGGVGNETFDNMYLTVGSMDLGAGLNIFNNKTN
FT                   AVYLMGDTVYLDLAGQFDNDGFAAPGGLDRVMTTDVTGNWSQSLGGVYLLDLDLDPEAD
FT                   RINVSGTADVNGLVSINIMNPGAAKPGNQDYIILEAQGGVTDNGLKLDTIPSAVAQYAL
FT                   KYPNPEDIVLNVDINFARTGLTENQTAVGQAINAIQTDLTSPNFTKIANAIFYIPTLDQ
FT                   LGAVYDTISGEGISGFQQPEFDANSTFLAQMSRQADAWRMGIATDPMSQSLKAPEAAYA
FT                   EPPGKTNPFDALANGPNEQRWSYWATAGGNSGAVTGDPVVGSAALDYKSGNFAVGLDSQ
FT                   GDPDVLMGFALGGVAGSFAVPDRETSGNIIGGHAGAYGARKWGQFYINGSLAMDLYSNT
FT                   TDRFTSVPGAPNPLNPVPPITREHWTGDFMSAGFGTSLEAGWRRPFGAGAITPFAGLQF
FT                   QALAMQAFSEKSTSDGALGLDFDSRTVISLPVSLGLQLDTTMAIGESKTLQAWGRAAWL
FT                   HEFKPDRSVEPGFQAAPGYAFVVQGAGAAEDAITVNAGVKLNWSANTSVFATFDGKFAD
FT                   RVQTYGGNVGFRVNW"
     MTLTLFVGST GPAEATCTGP SGGVETCAGS GTQSDISYTA PGVTTLNVNT LTIDPSRISL        60
     TGSGANPAPA TEVQHYTCST GNAADCVITP EKPAQNGNPA VAESCAVASG APAGTSCVAP       120
     PVKAAGGPSG NSGPTLVVNY NQPTANTNTP NSGAVIATGT IGVLGASNGS RGGNGSNGYV       180
     FSDGGDGANG ADGGIVTVNV DGAVMTSNNC VLPTACPNAG IVASSVGGDG GDGGDAKGIS       240
     GDAGDGGLGG SGGNATVNFN SGSVETQGNY SAGIAAISQG GHGGNGGGGG GLVFNPGGGS       300
     PAGAGGNANV FTGVGTTITT YGIYSHGIAA QSIGGGGGGS AGGFGLFSSS GGSGGNGGNG       360
     GIVQVTNNAN IATWGNNSQG ILAQTIGGGG GDGGSNFGLF ASGGSGSLGG NGGPANVVTV       420
     GVTNSGAIVT HGQESNGILA QSIGGGGGNG GNSGGLVSLG GDGASTTNGG IVEVTNTSAG       480
     SISTDGKQSA GIFAQSVGGG GGNGGTSGGL FSAGGKGGAG GNGARVTVTN AGDIETGKNG       540
     AASVNSAGIF AQSVGGGGGN GGGAFSGGIG FSVAIGGAGG SGGTSGAVEV LRDANDTAYS       600
     IITHGDQSDA VFAQSIGGGG GNGGFSVSGA VGVLALAMGG AAGNASDGNI VTVETAGSLT       660
     TYGQGSRGIF AQSIGGTGGN GGAAIAVAVN ATGTFAAAIG IGGNGGAGGA SKLVTVSSLS       720
     DISTAGNNAG GIVAQSVGGG GGNGGYAIGG AIGGAVGIAV NIGGKGAGGG AGADVIVGSS       780
     GSIHTKGNNS TGILAQSVGG GGGNGGFTIS AALGGGAASV GLGGAGADGS NAGNVTVSAD       840
     GAGHTVATTY TGTWNLVTEG KNAVGIQAES IGGGGGNGGF SGSLAAGGLV GVGVSLGGTG       900
     GGGGDAGTAT VNNGKKVGNT VTHNNILTIE DNSTGILAQS IGGGGGNGGF AVTLSVSGSY       960
     EGAGGAAAVS VGGSGATGGV GKDVFVTSYG NIATYGKQSD GILAQSIGGG GGNGGFSVAG      1020
     TFTTGALGAS VAVGGSGGSG QSAGEVTVTS AGNIQTHGDQ SIGIMAQSVG GGGGNGGFAG      1080
     AGAITLQGVS AAVGLGGSGA GGGSAKTVRV TSTGDITTYG DQAIGILAQS VGGGGGNGGS      1140
     TVSLALAKDA GIGVALGGKG GAAGNGLDVT VISTGNISTG AGFISGGVRG TGAAGILAQS      1200
     VGGGGGNGGF AGTLGGGKSI AVGVAFGGSG AGGGSADIVK VTSTGNISTN FDNSSGIIAQ      1260
     SIGGGGGNGG FSVAVTGALG DPDAATASVA IGGKGGVGGV GKDVTVTSTG TITTTGKFSN      1320
     GILAQSIGGG GGNGGFAVAG SATTGNAGIG VGVGGTGATG SASGKVIVNS YSLVGANGQP      1380
     VLLAPASNIV SIWTQGDNSS GIFAQSVGGG GGSGGFAGSL GVGLGGGGLG VSIGGGAGSG      1440
     STAETVTVTS YNNILTGGKD SFGIMAQSVG GGGGNGGFAI ALAGSKDMAA SVAVGGSGSS      1500
     GGDAAVVTVT SHGNIETDGD GSHAIFAQSV GGGGGNGGGA IAGTLTGEGT GSLAVGVGGS      1560
     GDNGGNAKAV TVSSTGDLRT EGLKADGILA QSIGGGGGNG GFSGALAITT GAGAIGVGVG      1620
     GSGKGGGNAD TVTVTSTGNI VTLKNGSNGI LAQSVGGGGG NGGAAVTIAG SGQKAAAAVS      1680
     VGGSGAKGGT SQLVTVNNIG TIDTTGDKAN GILAQSIGGG GGTGGFAISG EMVVDGAGGA      1740
     AVSVGGNGGT GQDGGRVIVN SNIGTTLANN NATIHTVGGD SNGIFAQSVG GGGGDGGFSG      1800
     AVSVTGQNAK AAIGVSVGGS GAGSGDGKTV NVTSVDNILT GGNGANGILA QSVGGGGGNG      1860
     GFSFAATIKG SLGKNPSKNG AVSVSLGGGA GSGGDAEKVT VDSTGIIQTS GNKAFGVLAQ      1920
     SVGGGGGTGG LSVAAALNLG EGGNQITAAV GGEGGGGGTG GEVLLTRHGS TITTGDQSVG      1980
     LFAQSVGGSG GNGGMAISGV IAGTDAKTLS ASVGGFGGAG TNASKVTVDN TGAISTYGVE      2040
     SDAIQAQSIG GGGGNGGMAV SAVIGSLGTG TNFNAGVTVG GFGGDAGFAG DVFVTNHGLL      2100
     QTGLLAAGQT TTNGDGAYGI FAQSVGGGGG SGGNAITGVL GLKGNNAGTQ VNVSVAVGGS      2160
     AGNGNTGGNV TIRQYGGIET NGMGAFGILA QSIGGGGGTG GRANSISLQL GAKCTLPKVC      2220
     EPAGGKPNWN LQATVGGAGG TGNDAMTVDV GNYDFITTDG DKSSGIVAQS IGGGGGIGGD      2280
     AYVGTGGLLA IPYVPVDPTL LLKPLGTSSL TRSGTVAIGG NGAGGGNGGT VIVANEGVIT      2340
     THGTKSDGIH AQSIGGGGGD GGDGEAGALG TVGLGGQGKA AGNGGSVTVT NGKANLSQAG      2400
     AAIIQTFGTS PTPPAEGAPS ADPEQGYSAG IFAQSVGGGG GTGGGAGGLL SLGGSGKAGG      2460
     TGGHVTVNNY GGILTHADDS VGIFAQSIGG GGGAGGSLGI SAIAVGGSGG ASGSGGQVDV      2520
     VNNAMIETHG IDSYAIQAQS VGGGGGSGGG KNGGITGSIP ALISIGGAGG SSGIGGIVNV      2580
     TNNNSLHTYG AGADGINAQS IGGGGGSGGR AIGFIAVGGK GGDVGNGTTA GSNGGGGAVT      2640
     VNNNANGTIT VEGIGAHGIF AQSVGAGGGS GGGAFGVSIV PVAIGVGGGG GSSGDGGVVT      2700
     VNNHGDITTV SASSVAIFAE SIGGGGGTGA MSVAASPAPG AFTFGIGGDG GANGKGGNVN      2760
     VTNFSDGIIH TQGFGSTGIM AQSVGGGGGA GGASYSVSGG PPGLAIALGG KGAAGGDGGI      2820
     VTVINNGAMQ LDGDNSVAIF AQSVGGGGGS GGTAIAAAIG VPVFIGGDTG ATGKGGDVTV      2880
     TNTGQIRLTG NGSVGIFAQS VGGGGGVVTA GTDGIVQAVA GGSGNGGVVT INSNVAMLIT      2940
     GDNSVGVFGQ SIGGGGGVGG FSGNYLGLDQ VQSTSSKMAM APQGFMGSAG GGGTGGAITF      3000
     TQTADLAVIG KNSFALMEQS AGGTGNISDN GDINVTIASG VTIIGGSGAG GGIGYKDGKD      3060
     NVLTNNGIVR SVLLIDGYAM RGGVGNETFD NMYLTVGSMD LGAGLNIFNN KTNAVYLMGD      3120
     TVYLDLAGQF DNDGFAAPGG LDRVMTTDVT GNWSQSLGGV YLLDLDLDPE ADRINVSGTA      3180
     DVNGLVSINI MNPGAAKPGN QDYIILEAQG GVTDNGLKLD TIPSAVAQYA LKYPNPEDIV      3240
     LNVDINFART GLTENQTAVG QAINAIQTDL TSPNFTKIAN AIFYIPTLDQ LGAVYDTISG      3300
     EGISGFQQPE FDANSTFLAQ MSRQADAWRM GIATDPMSQS LKAPEAAYAE PPGKTNPFDA      3360
     LANGPNEQRW SYWATAGGNS GAVTGDPVVG SAALDYKSGN FAVGLDSQGD PDVLMGFALG      3420
     GVAGSFAVPD RETSGNIIGG HAGAYGARKW GQFYINGSLA MDLYSNTTDR FTSVPGAPNP      3480
     LNPVPPITRE HWTGDFMSAG FGTSLEAGWR RPFGAGAITP FAGLQFQALA MQAFSEKSTS      3540
     DGALGLDFDS RTVISLPVSL GLQLDTTMAI GESKTLQAWG RAAWLHEFKP DRSVEPGFQA      3600
     APGYAFVVQG AGAAEDAITV NAGVKLNWSA NTSVFATFDG KFADRVQTYG GNVGFRVNW       3659
//

If you have problems or comments...

PBIL Back to PBIL home page