(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0964

BA000012.MLL0964     Location/Qualifiers
FT   CDS             complement(785649..788696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0964"
FT                   /product="probable conjugal transfer protein; TraA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48437"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48437"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LM6"
FT                   /protein_id="BAB48437.1"
FT                   /translation="MAIYHLHVKVIGRKAGSSAVASAAYRSASRLRDERIERTHDFSAK
FT                   RGVVHSEVMLPEDAPEAWRDRERLWNDVEAFEVRKDAQLAREVEFALPRELSQAQGIEL
FT                   ARDFVEAEFVSKGMAADLNVHWDRAEDGSPKPHAHVMLTMRAVDENGFGAKVRGWNATQ
FT                   LVERWRERWAELANERLADLDIDARIDHRSLEAQGIALEPQTQIGAPAQRIEGSGLAAG
FT                   DSEADRAELHREIARNNGARIIADPSVALDAITHQQSTFTRKDIAKFSHRHSDGMEQFN
FT                   AVVAAIGNAPHLVELGKDGRGEDRFTTRQMIDTEQRLHRAAERMDLDERHAVSDAYREA
FT                   VLARAAQRGLILSGEQTDALAHITDGRGLGVVVGFAGTGKSAMLGVARQAWAAAGYEVR
FT                   GAALSGIAAENLEGGSGIPSRTIASMEHSWGQGRDLLTARDVLVIDETGMVGTRQLERV
FT                   LSHAANVGAKVVLVGDPQQLQAIEAGAAFRSIHERHGGVEIGQVRRQREDWQRDATRDL
FT                   ATGRIGAAINAYDAQGMVHQAATRDDARSELVERWDRDRQAHPEASRIILTHTNDEVHA
FT                   LNQAARERMHAAGDLGDDVQVTVERGPRNFASGDRAMFLRNERALGVRNGTLGMIEQVS
FT                   TQSMTVRTDDGRLVRFDLKDYSHIDHGYAATIHKAQGMTVDRTHVLATPGMDAHGSYVA
FT                   LSRHRDAMDLHYGGDDFSTRDRLVRTLSRDRAKDMASDYEQIDPAQSYAERRGITFRER
FT                   VVEIVRRIVPEKLRDRIGGLIDGLRSPGDVEPGQDLGRRPARENVGAQIADDAATPERE
FT                   KPGPGAQRDTDLPMDPEAALRSARTKALVRHARALDAMSHNANADGRGSSDLMRELRDA
FT                   RNAFEKVRPYGWRDAEAAYVKNPELVREAGAGRVSRIVLALQLETEIRTGMDIDPGRRA
FT                   DRFVERWQKLDRTGQRQYQAGDMSGYKSTRSAMSDMAKSLERDPQLESLLANRKRELGI
FT                   KIDSGRRLGAELAFSHGIGKGRGLGL"
     MAIYHLHVKV IGRKAGSSAV ASAAYRSASR LRDERIERTH DFSAKRGVVH SEVMLPEDAP        60
     EAWRDRERLW NDVEAFEVRK DAQLAREVEF ALPRELSQAQ GIELARDFVE AEFVSKGMAA       120
     DLNVHWDRAE DGSPKPHAHV MLTMRAVDEN GFGAKVRGWN ATQLVERWRE RWAELANERL       180
     ADLDIDARID HRSLEAQGIA LEPQTQIGAP AQRIEGSGLA AGDSEADRAE LHREIARNNG       240
     ARIIADPSVA LDAITHQQST FTRKDIAKFS HRHSDGMEQF NAVVAAIGNA PHLVELGKDG       300
     RGEDRFTTRQ MIDTEQRLHR AAERMDLDER HAVSDAYREA VLARAAQRGL ILSGEQTDAL       360
     AHITDGRGLG VVVGFAGTGK SAMLGVARQA WAAAGYEVRG AALSGIAAEN LEGGSGIPSR       420
     TIASMEHSWG QGRDLLTARD VLVIDETGMV GTRQLERVLS HAANVGAKVV LVGDPQQLQA       480
     IEAGAAFRSI HERHGGVEIG QVRRQREDWQ RDATRDLATG RIGAAINAYD AQGMVHQAAT       540
     RDDARSELVE RWDRDRQAHP EASRIILTHT NDEVHALNQA ARERMHAAGD LGDDVQVTVE       600
     RGPRNFASGD RAMFLRNERA LGVRNGTLGM IEQVSTQSMT VRTDDGRLVR FDLKDYSHID       660
     HGYAATIHKA QGMTVDRTHV LATPGMDAHG SYVALSRHRD AMDLHYGGDD FSTRDRLVRT       720
     LSRDRAKDMA SDYEQIDPAQ SYAERRGITF RERVVEIVRR IVPEKLRDRI GGLIDGLRSP       780
     GDVEPGQDLG RRPARENVGA QIADDAATPE REKPGPGAQR DTDLPMDPEA ALRSARTKAL       840
     VRHARALDAM SHNANADGRG SSDLMRELRD ARNAFEKVRP YGWRDAEAAY VKNPELVREA       900
     GAGRVSRIVL ALQLETEIRT GMDIDPGRRA DRFVERWQKL DRTGQRQYQA GDMSGYKSTR       960
     SAMSDMAKSL ERDPQLESLL ANRKRELGIK IDSGRRLGAE LAFSHGIGKG RGLGL           1015
//

If you have problems or comments...

PBIL Back to PBIL home page