(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0002

BA000012.MLR0002     Location/Qualifiers
FT   CDS             287..1084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0002"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47682"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47682"
FT                   /db_xref="GOA:Q98NS9"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS9"
FT                   /protein_id="BAB47682.1"
FT                   /translation="MFWVTKKALMPFLMLPAGIIFVSAVGYAINWLFSTLFQFQPPLVE
FT                   GPAGPVTVLIFTITMLLAYDISYYLYHVAQHRYPLLWELHKVHHSAEVMVGITKDRVHP
FT                   LDELMNRAWDGLIVGICFGIWSLISLNLVELTVFGVNVYVMRNILMMDFVRHTHFKISF
FT                   GPLNNVILCPHWHQLHHSTDPRHYDKNFGLLFSFWDRLFGTLCVPKPDEDFKFGLVDRN
FT                   VRDYQSLAGLYVMPLKRMWGHIARRIRPAKSRTVQSSEEGTRP"
     MFWVTKKALM PFLMLPAGII FVSAVGYAIN WLFSTLFQFQ PPLVEGPAGP VTVLIFTITM        60
     LLAYDISYYL YHVAQHRYPL LWELHKVHHS AEVMVGITKD RVHPLDELMN RAWDGLIVGI       120
     CFGIWSLISL NLVELTVFGV NVYVMRNILM MDFVRHTHFK ISFGPLNNVI LCPHWHQLHH       180
     STDPRHYDKN FGLLFSFWDR LFGTLCVPKP DEDFKFGLVD RNVRDYQSLA GLYVMPLKRM       240
     WGHIARRIRP AKSRTVQSSE EGTRP                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page