(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0003

BA000012.MLR0003     Location/Qualifiers
FT   CDS             1006..2223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0003"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47683"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47683"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS8"
FT                   /protein_id="BAB47683.1"
FT                   /translation="MGAYCQAHPACKVTDRTVIGRRDAAMNAPFVLAIPRTRTFEVVTS
FT                   AARLAEIAPAWTALWQRAGGLVFQHPDWIAAWWRTTPHQERRTLRIGLAWNGDRLDGVI
FT                   ALATFRRSGIRMLEWAAKDHSDYGDALVAPDSDPQVISRLWQHVFDQGGFDLAYLNRLL
FT                   PDAGVRALLDPASRHARALRPNHRSEISYRVVGPWQSGAEWFETLSKKARQNYRRGRKF
FT                   MEEGGAVRFRLLGADDPREPVLARVAVLKRLWLARHGRVSDLFDKGSPVLAALVSVLAE
FT                   LGLLRIFVLELDDTIIAVSINFEQHGTMMAFVTTYDPEYERASPGMVLMMDYIQWSLDR
FT                   GLAKVDFLCGGEDFKRRFATQSVRLSSMIGARGLRGHLAALADRAVHVTKSSRAQRQPN
FT                   AQTPDE"
     MGAYCQAHPA CKVTDRTVIG RRDAAMNAPF VLAIPRTRTF EVVTSAARLA EIAPAWTALW        60
     QRAGGLVFQH PDWIAAWWRT TPHQERRTLR IGLAWNGDRL DGVIALATFR RSGIRMLEWA       120
     AKDHSDYGDA LVAPDSDPQV ISRLWQHVFD QGGFDLAYLN RLLPDAGVRA LLDPASRHAR       180
     ALRPNHRSEI SYRVVGPWQS GAEWFETLSK KARQNYRRGR KFMEEGGAVR FRLLGADDPR       240
     EPVLARVAVL KRLWLARHGR VSDLFDKGSP VLAALVSVLA ELGLLRIFVL ELDDTIIAVS       300
     INFEQHGTMM AFVTTYDPEY ERASPGMVLM MDYIQWSLDR GLAKVDFLCG GEDFKRRFAT       360
     QSVRLSSMIG ARGLRGHLAA LADRAVHVTK SSRAQRQPNA QTPDE                       405
//

If you have problems or comments...

PBIL Back to PBIL home page