(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0010

BA000012.MLR0010     Location/Qualifiers
FT   CDS             8483..8815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0010"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47688"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47688"
FT                   /db_xref="GOA:Q98NS3"
FT                   /db_xref="InterPro:IPR011499"
FT                   /db_xref="InterPro:IPR014546"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS3"
FT                   /protein_id="BAB47688.1"
FT                   /translation="MFNVLQELGTWLHQVFIKQFDAWILLGFVAQFFFTMRFVVQWLAS
FT                   EKAKRSVVPVAFWFFSLFGGGLLLIYAIQRQDPVFIAGQAMGMFIYIRNLWLIANERKA
FT                   AMTKVD"
     MFNVLQELGT WLHQVFIKQF DAWILLGFVA QFFFTMRFVV QWLASEKAKR SVVPVAFWFF        60
     SLFGGGLLLI YAIQRQDPVF IAGQAMGMFI YIRNLWLIAN ERKAAMTKVD                  110
//

If you have problems or comments...

PBIL Back to PBIL home page