(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0012

BA000012.MLR0012     Location/Qualifiers
FT   CDS             10632..11366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0012"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47690"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47690"
FT                   /db_xref="GOA:Q98NS1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS1"
FT                   /protein_id="BAB47690.1"
FT                   /translation="MRIVRGRFAARPARYPNIAWPVWGLVWLLLTAVAFVRLDTPAGMV
FT                   HGQWSGAGLAEFLTQFALGGWYLIPSALLLVAANLTDWRGLSRRSLMLVYNWTCLAFLV
FT                   LSAVGLSGLLVNVLKYAIGRARPLYFQDFGVLALHPFAFDARFAGFPSGHATTMGAVFG
FT                   VLLLLFPRRWHIALVVTACLASTRVFVGAHYPSDTVAGFGLGCAFALACGLVFARLGFI
FT                   FRATPSGLPVRKASFRLIAPQK"
     MRIVRGRFAA RPARYPNIAW PVWGLVWLLL TAVAFVRLDT PAGMVHGQWS GAGLAEFLTQ        60
     FALGGWYLIP SALLLVAANL TDWRGLSRRS LMLVYNWTCL AFLVLSAVGL SGLLVNVLKY       120
     AIGRARPLYF QDFGVLALHP FAFDARFAGF PSGHATTMGA VFGVLLLLFP RRWHIALVVT       180
     ACLASTRVFV GAHYPSDTVA GFGLGCAFAL ACGLVFARLG FIFRATPSGL PVRKASFRLI       240
     APQK                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page