(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0020

BA000012.MLR0020     Location/Qualifiers
FT   CDS             17309..18601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0020"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47697"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47697"
FT                   /db_xref="GOA:Q98NR4"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NR4"
FT                   /protein_id="BAB47697.1"
FT                   /translation="MPEGKVKLMNMHTQPQRTPAETALIDAFGDRLSLLPGDGAVMLKR
FT                   DDAIEAIKHGLPTRRVESWHYTDLRRLLSVVPDFDPAAMAKAIAPIVEGSAVLPVLNGK
FT                   SDAKVPALDGVTVQSLSEKLIDGSIAPGLDSYGSDDAIGALNTAFVADGYFVDIADGTE
FT                   LEKPIELQNVQAGGQTHVRLAVRVGAGAKAVIVERQAGDGAALVSSVSQLVLGEDAEVT
FT                   WLIVQEQPDTATHLAQFKAHIGKNAKLTLFVMNAGGKLVRQEVMVKTTGEGADFKLRGI
FT                   NLLAGDTHSDVTMVLDHAVPHTTSTEVIRNVVTGKARGVFQGRINVHQYAQKTNAKMAC
FT                   NTLLLSDDGEFSTKPELEIFADDVVCGHGATVTEIDHDHLFYLMARGVDEKSARGLLVK
FT                   AFVAEVIEELDDETIVEALEARLDEWFVTHG"
     MPEGKVKLMN MHTQPQRTPA ETALIDAFGD RLSLLPGDGA VMLKRDDAIE AIKHGLPTRR        60
     VESWHYTDLR RLLSVVPDFD PAAMAKAIAP IVEGSAVLPV LNGKSDAKVP ALDGVTVQSL       120
     SEKLIDGSIA PGLDSYGSDD AIGALNTAFV ADGYFVDIAD GTELEKPIEL QNVQAGGQTH       180
     VRLAVRVGAG AKAVIVERQA GDGAALVSSV SQLVLGEDAE VTWLIVQEQP DTATHLAQFK       240
     AHIGKNAKLT LFVMNAGGKL VRQEVMVKTT GEGADFKLRG INLLAGDTHS DVTMVLDHAV       300
     PHTTSTEVIR NVVTGKARGV FQGRINVHQY AQKTNAKMAC NTLLLSDDGE FSTKPELEIF       360
     ADDVVCGHGA TVTEIDHDHL FYLMARGVDE KSARGLLVKA FVAEVIEELD DETIVEALEA       420
     RLDEWFVTHG                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page