(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0030

BA000012.MLR0030     Location/Qualifiers
FT   CDS             24004..25101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0030"
FT                   /product="recombination protein; RecA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47705"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47705"
FT                   /db_xref="GOA:Q98NQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NQ6"
FT                   /protein_id="BAB47705.1"
FT                   /translation="MAQNSLRLVEDKAVDKSKALDAALSQIERAFGKGSIMRLGANEQV
FT                   VEIETVPTGSLGLDIALGVGGLPRGRIIEIYGPESSGKTTLALHTVAEAQKKGGICAFV
FT                   DAEHALDPVYARKLGVDLENLLISQPDTGEQALEICDTLVRSGAIDVLVVDSVAALTPR
FT                   AEIEGEMGDSLPGLQARLMSQALRKLTASISRSNTMVIFINQIRMKIGVMFGSPETTTG
FT                   GNALKFYASVRLDIRRIGSVKDRDEVVGNQTRVKVVKNKLAPPFKVVEFDIMYGEGVSK
FT                   TGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKLFLRDNPDTAREIELALRQNAGL
FT                   IAEKFLENGGSEGGDDGFEDEAGAM"
     MAQNSLRLVE DKAVDKSKAL DAALSQIERA FGKGSIMRLG ANEQVVEIET VPTGSLGLDI        60
     ALGVGGLPRG RIIEIYGPES SGKTTLALHT VAEAQKKGGI CAFVDAEHAL DPVYARKLGV       120
     DLENLLISQP DTGEQALEIC DTLVRSGAID VLVVDSVAAL TPRAEIEGEM GDSLPGLQAR       180
     LMSQALRKLT ASISRSNTMV IFINQIRMKI GVMFGSPETT TGGNALKFYA SVRLDIRRIG       240
     SVKDRDEVVG NQTRVKVVKN KLAPPFKVVE FDIMYGEGVS KTGELVDLGV KAGVVEKSGA       300
     WFSYNSQRLG QGRENAKLFL RDNPDTAREI ELALRQNAGL IAEKFLENGG SEGGDDGFED       360
     EAGAM                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page