(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0033

BA000012.MLR0033     Location/Qualifiers
FT   CDS             28039..28395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0033"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47707"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47707"
FT                   /db_xref="GOA:Q98NQ4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ4"
FT                   /protein_id="BAB47707.1"
FT                   /translation="MNVLVLGGYGLIGDAVIGRLLRDGHHVTGLGRDVPDAGRRRPAVR
FT                   WIAADMSKLLAAEDWLPVVAGMDAVVKFGSAIWRGRRPSKTHRCPPKRNACFASGLLAV
FT                   FQPLARRLRSSGRW"
     MNVLVLGGYG LIGDAVIGRL LRDGHHVTGL GRDVPDAGRR RPAVRWIAAD MSKLLAAEDW        60
     LPVVAGMDAV VKFGSAIWRG RRPSKTHRCP PKRNACFASG LLAVFQPLAR RLRSSGRW         118
//

If you have problems or comments...

PBIL Back to PBIL home page