(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0047

BA000012.MLR0047     Location/Qualifiers
FT   CDS             37184..37999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0047"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47717"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47717"
FT                   /db_xref="GOA:Q98NP4"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NP4"
FT                   /protein_id="BAB47717.1"
FT                   /translation="MPSSVEFNKLRKRLLRLTRQAIEDFSMVEPGQRWLVALSGGKDSY
FT                   GLLALLLDLKWRGLLPVELLACNLDQGQPNFPKHILPDYLNANGIAHRIEYQDTYSVVT
FT                   NKLPEGSTYCSLCSRLRRGHLYRIAREEGCSALVLGHHREDILETFFMNLFHGGRLAAM
FT                   PPKLLNDEGDVMVLRPLSYCAEIDLEKFAAAMRFPIIPCDLCGSQEGLQRNAMKAMLED
FT                   IEKRMPGRKDTMIRALSNTRPSHLLDRKLFDFAALNQTLITGQDASDDI"
     MPSSVEFNKL RKRLLRLTRQ AIEDFSMVEP GQRWLVALSG GKDSYGLLAL LLDLKWRGLL        60
     PVELLACNLD QGQPNFPKHI LPDYLNANGI AHRIEYQDTY SVVTNKLPEG STYCSLCSRL       120
     RRGHLYRIAR EEGCSALVLG HHREDILETF FMNLFHGGRL AAMPPKLLND EGDVMVLRPL       180
     SYCAEIDLEK FAAAMRFPII PCDLCGSQEG LQRNAMKAML EDIEKRMPGR KDTMIRALSN       240
     TRPSHLLDRK LFDFAALNQT LITGQDASDD I                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page