(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0048

BA000012.MLR0048     Location/Qualifiers
FT   CDS             37989..38816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0048"
FT                   /product="monophosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47718"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47718"
FT                   /db_xref="GOA:Q98NP3"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NP3"
FT                   /protein_id="BAB47718.1"
FT                   /translation="MTFDDNAIDWLASLLAEAADTEIMPRFRRLGDGDIRQKTSAADLV
FT                   TEADVNAERLITTRLRQNYPSAMVVGEEACSDDPALLDGLGDADLAFVIDPVDGTFNFA
FT                   SGVPLFGVMLGVVVKGETVAGIIHDPVGKDWLIGAKGGGSHIRHAHGSLEKVRVAASAP
FT                   ISQMTGAVSWQYMAEPDRTRLACNQTKTLSQFNYRCAAHEYRLLASGHGHFVVYNKLMP
FT                   WDHLAGVLIHAEAGGHAARFDGSAYLPSHVGGGLLVAPDRESWQELRRELWAG"
     MTFDDNAIDW LASLLAEAAD TEIMPRFRRL GDGDIRQKTS AADLVTEADV NAERLITTRL        60
     RQNYPSAMVV GEEACSDDPA LLDGLGDADL AFVIDPVDGT FNFASGVPLF GVMLGVVVKG       120
     ETVAGIIHDP VGKDWLIGAK GGGSHIRHAH GSLEKVRVAA SAPISQMTGA VSWQYMAEPD       180
     RTRLACNQTK TLSQFNYRCA AHEYRLLASG HGHFVVYNKL MPWDHLAGVL IHAEAGGHAA       240
     RFDGSAYLPS HVGGGLLVAP DRESWQELRR ELWAG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page