(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0071

BA000012.MLR0071     Location/Qualifiers
FT   CDS             50603..50923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0071"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47734"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM7"
FT                   /protein_id="BAB47734.1"
FT                   /translation="MSSMKDREEGFERKFAFDEELRFKASARRNKALGLWAAEKLGKSG
FT                   ADADAYAKEVVVSDIEEAGDHDVFRKIRKDFDAAGVEQSDHQIRRTMDELMAQAIEQIK
FT                   NT"
     MSSMKDREEG FERKFAFDEE LRFKASARRN KALGLWAAEK LGKSGADADA YAKEVVVSDI        60
     EEAGDHDVFR KIRKDFDAAG VEQSDHQIRR TMDELMAQAI EQIKNT                      106
//

If you have problems or comments...

PBIL Back to PBIL home page