(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0092

BA000012.MLR0092     Location/Qualifiers
FT   CDS             63427..64164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0092"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47749"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47749"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NL2"
FT                   /protein_id="BAB47749.1"
FT                   /translation="MDPYALKALNAERRARRAAILVTDLGDGRDRIVREGDQVAGDLGA
FT                   AIAKAFRSGNSGSVEAEGRTFFLNAHLPQPRLLVIGAVHISQALAPMAKIAGYPVEIID
FT                   PRTAFATPDRFPDVALHAEWPEDVLKRQPLDSYTALAAVTHDPKIDDFALKAALDANCF
FT                   YVGALGSRKTHAKRVERLLALGAAADQIARIHAPIGLDIGAASPAEIAVAILAQTIYAF
FT                   RSRGLDVSASAQRSESILEKHDA"
     MDPYALKALN AERRARRAAI LVTDLGDGRD RIVREGDQVA GDLGAAIAKA FRSGNSGSVE        60
     AEGRTFFLNA HLPQPRLLVI GAVHISQALA PMAKIAGYPV EIIDPRTAFA TPDRFPDVAL       120
     HAEWPEDVLK RQPLDSYTAL AAVTHDPKID DFALKAALDA NCFYVGALGS RKTHAKRVER       180
     LLALGAAADQ IARIHAPIGL DIGAASPAEI AVAILAQTIY AFRSRGLDVS ASAQRSESIL       240
     EKHDA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page