(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0110

BA000012.MLR0110     Location/Qualifiers
FT   CDS             78525..79106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0110"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47765"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47765"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NJ6"
FT                   /protein_id="BAB47765.1"
FT                   /translation="MESLSIIFRWFVGLRSVGSSLGRKPDQTEETTLTTKLDIAPANDR
FT                   ELVVARIIDAPRENVYRCWTDTRLLTQWFSPKPWTTPRAEMDMRTGGSSLVIMADPDGN
FT                   EFPNPGVFLEVIPGKKIIFTDAYTQAWEPSEKPFMTGVLTFEDEGEGRTRYIARVRHWS
FT                   VADRERHEAMGFHVGWGQCTDQLEDLARTL"
     MESLSIIFRW FVGLRSVGSS LGRKPDQTEE TTLTTKLDIA PANDRELVVA RIIDAPRENV        60
     YRCWTDTRLL TQWFSPKPWT TPRAEMDMRT GGSSLVIMAD PDGNEFPNPG VFLEVIPGKK       120
     IIFTDAYTQA WEPSEKPFMT GVLTFEDEGE GRTRYIARVR HWSVADRERH EAMGFHVGWG       180
     QCTDQLEDLA RTL                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page