(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0150

BA000012.MLR0150     Location/Qualifiers
FT   CDS             105672..106250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0150"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47797"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47797"
FT                   /db_xref="GOA:Q98NG4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NG4"
FT                   /protein_id="BAB47797.1"
FT                   /translation="MEDRIRIRSEEVLSDDWAVLKKTVLDYRRRDGQWETQIRQTYDRG
FT                   DGAVILPYDPQRSTVLLVRQFRYPAYVTGHREPLIEACAGLLDENDPETAIRKEAEEEL
FT                   GYRLKDIERLFSPYMSPGSVTERLWFFIARYSPADRISAGGGAPEEGEDIEVLEMPLDE
FT                   ALAGIADGRIVDAKTIILIQHLKLNPMKA"
     MEDRIRIRSE EVLSDDWAVL KKTVLDYRRR DGQWETQIRQ TYDRGDGAVI LPYDPQRSTV        60
     LLVRQFRYPA YVTGHREPLI EACAGLLDEN DPETAIRKEA EEELGYRLKD IERLFSPYMS       120
     PGSVTERLWF FIARYSPADR ISAGGGAPEE GEDIEVLEMP LDEALAGIAD GRIVDAKTII       180
     LIQHLKLNPM KA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page